powered by:
Protein Alignment Lmpt and fhl2b
DIOPT Version :9
Sequence 1: | NP_996113.2 |
Gene: | Lmpt / 39889 |
FlyBaseID: | FBgn0261565 |
Length: | 2147 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001006028.2 |
Gene: | fhl2b / 450007 |
ZFINID: | ZDB-GENE-041010-121 |
Length: | 279 |
Species: | Danio rerio |
Alignment Length: | 50 |
Identity: | 12/50 - (24%) |
Similarity: | 26/50 - (52%) |
Gaps: | 6/50 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 1592 LDEGISDNNERTQPTD-ESHHDTSECEEAER----NADRYENRGAQDWEE 1636
:|:..|..:|:...|: .|:..:|:|.|.:: .:.:.|::| ..|.|
Zfish 76 VDKPFSTKDEQLLCTECYSNEYSSKCFECKKTIMPGSRKMEHKG-NSWHE 124
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
1 |
1.000 |
- |
- |
|
H20372 |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3257 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
2 | 2.030 |
|
Return to query results.
Submit another query.