DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmpt and fhl2b

DIOPT Version :9

Sequence 1:NP_996113.2 Gene:Lmpt / 39889 FlyBaseID:FBgn0261565 Length:2147 Species:Drosophila melanogaster
Sequence 2:NP_001006028.2 Gene:fhl2b / 450007 ZFINID:ZDB-GENE-041010-121 Length:279 Species:Danio rerio


Alignment Length:50 Identity:12/50 - (24%)
Similarity:26/50 - (52%) Gaps:6/50 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1592 LDEGISDNNERTQPTD-ESHHDTSECEEAER----NADRYENRGAQDWEE 1636
            :|:..|..:|:...|: .|:..:|:|.|.::    .:.:.|::| ..|.|
Zfish    76 VDKPFSTKDEQLLCTECYSNEYSSKCFECKKTIMPGSRKMEHKG-NSWHE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LmptNP_996113.2 GBP_C <103..201 CDD:303769
ARGLU 110..255 CDD:291991
coiled coil 170..181 CDD:293879
coiled coil 190..201 CDD:293879
fhl2bNP_001006028.2 LIM <7..33 CDD:295319
LIM 36..97 CDD:295319 5/20 (25%)
LIM 101..157 CDD:295319 5/24 (21%)
LIM3_Fhl2 162..218 CDD:188815
LIM4_FHL2 221..278 CDD:188817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20372
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3257
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.