DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmpt and Cp190

DIOPT Version :10

Sequence 1:NP_996113.2 Gene:Lmpt / 39889 FlyBaseID:FBgn0261565 Length:2147 Species:Drosophila melanogaster
Sequence 2:NP_524359.2 Gene:Cp190 / 41848 FlyBaseID:FBgn0000283 Length:1096 Species:Drosophila melanogaster


Alignment Length:43 Identity:11/43 - (25%)
Similarity:21/43 - (48%) Gaps:9/43 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly   140 LICLGGKTKQKG-FEILSS-----VIKQLMSTTMN---ELVEF 173
            ::|.||.|..:. ||...:     .::|...:.||   |:::|
  Fly   222 ILCNGGVTSTENVFEFYQTDNVPLSVRQRTGSDMNSFREIIDF 264

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LmptNP_996113.2 Smc <101..>371 CDD:440809 11/43 (26%)
PTZ00121 <105..689 CDD:173412 11/43 (26%)
Cp190NP_524359.2 BTB_POZ_CP190-like 16..125 CDD:349620
COG5236 <471..>594 CDD:227561
C2H2 Zn finger 540..568 CDD:275371
C2H2 Zn finger 569..586 CDD:275371
PTZ00121 <709..1075 CDD:173412
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.