DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmpt and Ibsp

DIOPT Version :9

Sequence 1:NP_996113.2 Gene:Lmpt / 39889 FlyBaseID:FBgn0261565 Length:2147 Species:Drosophila melanogaster
Sequence 2:NP_036719.2 Gene:Ibsp / 24477 RGDID:2855 Length:319 Species:Rattus norvegicus


Alignment Length:317 Identity:70/317 - (22%)
Similarity:107/317 - (33%) Gaps:82/317 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly  1428 ASSINFENFSRHLNADFLDSERRASDSALMGDMEPDEYHHFRRYSLAQE----QPVEEYPSDDYV 1488
            ||:.:.:||.|.:.|:  |||            |...:.:..||.|.:.    .|::.:|     
  Rat    14 ASAFSMKNFHRRIKAE--DSE------------ENGVFKYRPRYFLYKHAYFYPPLKRFP----- 59

  Fly  1489 YISQIEVRTLTGTRTWLKE----DFYTHEPNDFSDSKSPVRDEDSWARAVLAAEAEAAEFDSTNA 1549
                     :.|.....:|    |....|..:...|.....:|||.......||||.|......|
  Rat    60 ---------VQGGSDSSEENGDGDSSEEEGEEEETSNEEENNEDSEGNEDQEAEAENATLSGVTA 115

  Fly  1550 IYSYDIVGDHENLD----QERSSSNDSEDTRQTVVEID----DEDEFEFELDEGISDNNER---- 1602
            .|..:...|...|:    |....:.|:|.....:.|.|    :|:|.|.|.:|...|.||:    
  Rat   116 SYGVETTADAGKLELAALQLPKKAGDAEGKAPKMKESDEEEEEEEEEENENEEAEVDENEQVVNG 180

  Fly  1603 --TQPTD----------ESHHDTSECEEAERNADRYENRGAQDWEEVDDVEDFLDYGFDD----- 1650
              |..|:          ::..:..|....|..|:. ...||::..........|..||..     
  Rat   181 TSTNSTEVDGGNGPSGGDNGEEAEEASVTEAGAEG-TTAGARELTSYGTTTAVLLNGFQQTTPPP 244

  Fly  1651 GAVGGATPYSDPDSFIEQIYNEAIKNRKQSGILREYETIVQEQLPSDLSESEKEKSG 1707
            .|.|..:|.:...|.:|  |.|            |||.|..|.  :...|:..|.:|
  Rat   245 EAYGTTSPPARKSSTVE--YGE------------EYEQIGNEY--NTAYETYDENNG 285

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LmptNP_996113.2 GBP_C <103..201 CDD:303769
ARGLU 110..255 CDD:291991
coiled coil 170..181 CDD:293879
coiled coil 190..201 CDD:293879
IbspNP_036719.2 BSP_II 17..316 CDD:283165 68/314 (22%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 59..116 14/70 (20%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 135..224 19/89 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 237..263 6/27 (22%)
Cell attachment site 288..290
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG1181
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.