DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmpt and Leo1

DIOPT Version :10

Sequence 1:NP_996113.2 Gene:Lmpt / 39889 FlyBaseID:FBgn0261565 Length:2147 Species:Drosophila melanogaster
Sequence 2:NP_001034611.1 Gene:Leo1 / 235497 MGIID:2685031 Length:667 Species:Mus musculus


Alignment Length:198 Identity:39/198 - (19%)
Similarity:64/198 - (32%) Gaps:72/198 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly   125 AEKGIKEAKYVYG---VILICLGGKTKQKGFEILSSV---------------IKQLMSTTMNELV 171
            |||  ||.||.:.   |.:|    ..|.....::|.:               :|...|:...|::
Mouse    90 AEK--KEEKYSFNNSCVFII----MRKTPDTPVISPLPNDIKPGTAVTVKCSVKHTCSSHPPEII 148

  Fly   172 EFRYKIQKIRY--------GFWWSDNTVVEQLKTAYVSE-KCKCDCK--------------TRML 213
               :.:..:|.        |..|...:.|..:.|.|..| |..|:.|              :...
Mouse   149 ---WSVSTVRETISHNPMGGGVWETVSTVNFILTGYEEEDKIVCNAKFWGGKTQSNSSAPLSVKR 210

  Fly   214 LLVMNRGWYLFGDETDLDFSSACEL---YLY----------INRNFP-------FEAKKSKIDGE 258
            :..:..|.|:..  :.|.|...|.|   ::|          |.|:.|       |.::.|..||.
Mouse   211 IQAVGSGPYIIA--SSLVFILICILAGVFIYRRRQRQPCEDITRSEPRRSVWNRFSSRFSMPDGR 273

  Fly   259 IYW 261
            ..|
Mouse   274 AAW 276

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LmptNP_996113.2 Smc <101..>371 CDD:440809 39/198 (20%)
PTZ00121 <105..689 CDD:173412 39/198 (20%)
Leo1NP_001034611.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..362 39/198 (20%)
MSCRAMM_ClfA <9..362 CDD:468110 39/198 (20%)
Leo1 375..537 CDD:461126
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 548..585
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 602..667
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.