powered by:
Protein Alignment Lmpt and FHL2
DIOPT Version :9
Sequence 1: | NP_996113.2 |
Gene: | Lmpt / 39889 |
FlyBaseID: | FBgn0261565 |
Length: | 2147 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001034581.1 |
Gene: | FHL2 / 2274 |
HGNCID: | 3703 |
Length: | 279 |
Species: | Homo sapiens |
Alignment Length: | 50 |
Identity: | 11/50 - (22%) |
Similarity: | 25/50 - (50%) |
Gaps: | 6/50 - (12%) |
- Green bases have known domain annotations that are detailed below.
Fly 1592 LDEGISDNNERTQPTD-ESHHDTSECEEAER----NADRYENRGAQDWEE 1636
:|:..:...::...|| .|:..:|:|:|.:: ...:.|.:|: .|.|
Human 76 VDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGS-SWHE 124
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
1 |
1.000 |
- |
- |
|
H20372 |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
1 |
0.950 |
- |
0 |
Normalized mean entropy |
S2524 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R3257 |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
User_Submission |
0 | 0.000 |
Not matched by this tool. |
|
3 | 2.980 |
|
Return to query results.
Submit another query.