DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmpt and FHL2

DIOPT Version :10

Sequence 1:NP_996113.2 Gene:Lmpt / 39889 FlyBaseID:FBgn0261565 Length:2147 Species:Drosophila melanogaster
Sequence 2:NP_001441.4 Gene:FHL2 / 2274 HGNCID:3703 Length:279 Species:Homo sapiens


Alignment Length:50 Identity:11/50 - (22%)
Similarity:25/50 - (50%) Gaps:6/50 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly  1592 LDEGISDNNERTQPTD-ESHHDTSECEEAER----NADRYENRGAQDWEE 1636
            :|:..:...::...|| .|:..:|:|:|.::    ...:.|.:|: .|.|
Human    76 VDKPFAAKEDQLLCTDCYSNEYSSKCQECKKTIMPGTRKMEYKGS-SWHE 124

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LmptNP_996113.2 Smc <101..>371 CDD:440809
PTZ00121 <105..689 CDD:173412
FHL2NP_001441.4 LIM <5..33 CDD:413332
LIM1_FHL2 36..97 CDD:188806 4/20 (20%)
LIM2_FHL2 101..157 CDD:188810 5/24 (21%)
LIM3_Fhl2 162..218 CDD:188815
LIM4_FHL2 221..278 CDD:188817
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.