DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Lmpt and fhl2

DIOPT Version :9

Sequence 1:NP_996113.2 Gene:Lmpt / 39889 FlyBaseID:FBgn0261565 Length:2147 Species:Drosophila melanogaster
Sequence 2:NP_001120233.1 Gene:fhl2 / 100145283 XenbaseID:XB-GENE-969632 Length:279 Species:Xenopus tropicalis


Alignment Length:76 Identity:21/76 - (27%)
Similarity:29/76 - (38%) Gaps:11/76 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly   666 QLSKEQLDKE-AEKDNPQAVDTSDSNKSNLQTSIAAEEQSRGGSPGLRRSPRMDEMEHYPERWSA 729
            |..|..:||. |.||.........||:.:.:.|    |..:...||.|:      ||:....|..
 Frog    70 QCKKSLVDKPFAAKDEHLICTECYSNEYSSKCS----ECKKTIMPGTRK------MEYKGNSWHE 124

  Fly   730 SQEQQSVQQQP 740
            :....|..|||
 Frog   125 TCFICSRCQQP 135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
LmptNP_996113.2 GBP_C <103..201 CDD:303769
ARGLU 110..255 CDD:291991
coiled coil 170..181 CDD:293879
coiled coil 190..201 CDD:293879
fhl2NP_001120233.1 LIM <5..33 CDD:413332
LIM1_FHL2 36..97 CDD:188806 9/26 (35%)
LIM2_FHL2 101..157 CDD:188810 12/45 (27%)
LIM3_Fhl2 162..218 CDD:188815
LIM4_FHL2 221..278 CDD:188817
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H20372
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R3257
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.030

Return to query results.
Submit another query.