DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh4 and OPN1MW2

DIOPT Version :10

Sequence 1:NP_476701.1 Gene:Rh4 / 39887 FlyBaseID:FBgn0003250 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001041646.1 Gene:OPN1MW2 / 728458 HGNCID:26952 Length:364 Species:Homo sapiens


Alignment Length:122 Identity:28/122 - (22%)
Similarity:41/122 - (33%) Gaps:37/122 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    43 SELSFLSSLSSDPSPKPLSVNIGHIESVVRILQLPSITGVSRVCKPIPLPIGGVHVDLVCTLGKV 107
            ||||..|.....|||..              ..:|..:|:|.:.:...||..|..:.::.:||. 
Human   437 SELSRTSGFHLIPSPPK--------------YPMPPESGISSLGRSADLPFRGRRLRVLGSLGP- 486

  Fly   108 PVWIIVSDRNPRYISWNGDRHGSKGLRSRIEQILAAANSTTTLKPSSVILFFANGLP 164
                                  |.|..|.:.:.|||..:...|:.||.....|.|.|
Human   487 ----------------------SLGEGSVLGERLAAVTALRALEASSGPSHRAQGCP 521

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh4NP_476701.1 7tmA_photoreceptors_insect 55..345 CDD:320207 23/110 (21%)
TM helix 1 56..82 CDD:320207 3/25 (12%)
TM helix 2 89..114 CDD:320207 5/24 (21%)
TM helix 3 126..156 CDD:320207 9/29 (31%)
TM helix 4 166..186 CDD:320207
TM helix 5 214..243 CDD:320207
TM helix 6 273..303 CDD:320207
TM helix 7 313..338 CDD:320207
OPN1MW2NP_001041646.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..23
Required for 11-cis-retinal regeneration. /evidence=ECO:0000269|PubMed:30948514 17..43
7tm_GPCRs 42..333 CDD:475119
TM helix 1 56..80 CDD:410628
TM helix 2 89..111 CDD:410628
TM helix 3 127..149 CDD:410628
TM helix 4 171..187 CDD:410628
TM helix 5 217..240 CDD:410628
TM helix 6 267..289 CDD:410628
TM helix 7 301..326 CDD:410628
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.