DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh4 and opn6b

DIOPT Version :9

Sequence 1:NP_476701.1 Gene:Rh4 / 39887 FlyBaseID:FBgn0003250 Length:378 Species:Drosophila melanogaster
Sequence 2:NP_001303879.1 Gene:opn6b / 557053 ZFINID:ZDB-GENE-030616-402 Length:391 Species:Danio rerio


Alignment Length:299 Identity:74/299 - (24%)
Similarity:138/299 - (46%) Gaps:24/299 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 LGVFYIFLFCASTVGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDLIMCL----KAPIFIYNSFH- 116
            :||:.:.|...|.:|||.||.:.:..:....|.:...||||:.|..:.:    :..:.:::.|. 
Zfish    24 IGVYLVILGWLSWIGNGTVILLLTKQRKALEPQDFLTLNLAISDASISIFGYSRGILEVFDVFRD 88

  Fly   117 RGFALGNTW-CQIFASIGSYSGIGAGMTNAAIGYDRYNVITKPMNRNMTFTKAVIMNI-IIWLYC 179
            .|:.:...| |::...:....|:.:..|..||...||.....|.:.:....:.:.:.| .:||:|
Zfish    89 EGYLIKTFWTCKVDGFLILLFGLISINTLTAISVIRYIKGCHPHHAHHINKRNICLVITAVWLFC 153

  Fly   180 TPWVVLPLTQFWDRFVPEGYLTSCSFDYLSDNFDT--RLFVGTIFFFSFVCPTLMILYYYSQIVG 242
            ..|...||.. |..:...||.| |..|:....:..  :|:|..||||:|..|..:|::.|..|:.
Zfish   154 LFWAGAPLLG-WGSYRARGYGT-CEIDWTRALYSIPFKLYVIGIFFFNFFVPLFIIVFAYVSIIR 216

  Fly   243 HVFSHEKALREQAKKMNVESLRSNVDKSKETAEIRIAKAAITICFLFFVSWTPYGVMSLIGAFGD 307
            .|.|..|:           |...:|.:.::..|..|.:.::.:|..|.::|:||.|:|:..|.|.
Zfish   217 TVNSSHKS-----------SQGGDVSERQKKIERSITRVSLILCAAFLLAWSPYAVISMWSALGY 270

  Fly   308 KSLLTPGATMIPACTCKLVACIDPFVYAISHPRYRLELQ 346
            :.....|  ::.:...|..:..:||:|.....::|.:||
Zfish   271 QIPTLNG--ILASLFAKSASFYNPFIYIGMSSKFRKDLQ 307

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh4NP_476701.1 7tmA_photoreceptors_insect 55..345 CDD:320207 72/296 (24%)
TM helix 1 57..81 CDD:320207 9/23 (39%)
TM helix 2 90..111 CDD:320207 5/24 (21%)
TM helix 3 127..149 CDD:320207 4/21 (19%)
TM helix 4 170..186 CDD:320207 5/16 (31%)
TM helix 5 215..238 CDD:320207 9/22 (41%)
TM helix 6 279..301 CDD:320207 6/21 (29%)
TM helix 7 313..338 CDD:320207 5/24 (21%)
opn6bNP_001303879.1 7tm_1 38..295 CDD:278431 66/271 (24%)
7tm_4 <204..306 CDD:304433 25/114 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D310934at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.920

Return to query results.
Submit another query.