DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rh4 and Rrh

DIOPT Version :9

Sequence 1:NP_476701.1 Gene:Rh4 / 39887 FlyBaseID:FBgn0003250 Length:378 Species:Drosophila melanogaster
Sequence 2:XP_006232065.1 Gene:Rrh / 310869 RGDID:1308948 Length:337 Species:Rattus norvegicus


Alignment Length:296 Identity:67/296 - (22%)
Similarity:137/296 - (46%) Gaps:21/296 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    52 SMHYMLGVFYIFLFCASTVGNGMVIWIFSTSKSLRTPSNMFVLNLAVFDL-IMCLKAPIFIYNSF 115
            |.|.::..:.|.....|.:.|.:|:.||...|.||||:|..::|||..|: :..:..|:...:..
  Rat    23 SEHSIIAAYLIVAGIISILSNIIVLGIFIKYKELRTPTNAVIINLAFTDIGVSSIGYPMSAASDL 87

  Fly   116 HRGFALGNTWCQIFASIGSYSG-IGAGMTNAAIGYDRYNVITKP-MNRNMTFTKAVIMNIIIWLY 178
            |..:..|:..||::|.:..:.| :..|:. ..:..|||..|:.| :.|.||....:.|.:..|:.
  Rat    88 HGSWKFGHAGCQVYAGLNIFFGMVSIGLL-TVVALDRYLTISCPDVGRRMTGNTYLSMVLGAWIN 151

  Fly   179 CTPWVVLPLTQFWDRFVPEGYLTSCSFDYLSDNFDTRLFVGTIFFFSFVCP-TLMILYYYSQIVG 242
            ...|.::|:.. |..:.|:....:|:.::..::.....:...:...:|:.| |:|...||     
  Rat   152 GLFWALMPIVG-WASYAPDPTGATCTINWRKNDTSFVSYTMMVIVVNFIVPLTVMFYCYY----- 210

  Fly   243 HVFSHEKALREQAKKMNVESLRSNVDKSKETA-EIRIAKAAITICFLFFVSWTPYGVMSLIGAFG 306
            ||        .|:.:::..| ......:::.| :..:.|.::.:..:|.::|:||.|:.|...||
  Rat   211 HV--------SQSMRLSAAS-NCTTHLNRDWAHQADVTKMSVMMILMFLLAWSPYSVVCLWACFG 266

  Fly   307 DKSLLTPGATMIPACTCKLVACIDPFVYAISHPRYR 342
            :...:.|...:|.....|.....:|.:|..::.::|
  Rat   267 NPKKIPPSLAIIAPLFAKSSTFYNPCIYVAANKKFR 302

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rh4NP_476701.1 7tmA_photoreceptors_insect 55..345 CDD:320207 65/293 (22%)
TM helix 1 57..81 CDD:320207 6/23 (26%)
TM helix 2 90..111 CDD:320207 6/21 (29%)
TM helix 3 127..149 CDD:320207 4/22 (18%)
TM helix 4 170..186 CDD:320207 3/15 (20%)
TM helix 5 215..238 CDD:320207 5/23 (22%)
TM helix 6 279..301 CDD:320207 6/21 (29%)
TM helix 7 313..338 CDD:320207 5/24 (21%)
RrhXP_006232065.1 7tm_1 43..294 CDD:278431 61/266 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG48050
OrthoDB 1 1.010 - - D310934at33208
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
43.930

Return to query results.
Submit another query.