DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and AKR2

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_014677.1 Gene:AKR2 / 854199 SGDID:S000005560 Length:749 Species:Saccharomyces cerevisiae


Alignment Length:210 Identity:44/210 - (20%)
Similarity:76/210 - (36%) Gaps:46/210 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 YDTDGLFFKIAWLMALFIVYNLLGNMLACHRNSSAVTSLPK-----------DRQIPCPEEKHLW 104
            |....:.|.:...:.:.:...|:.:...|.:...::||:.:           ||:          
Yeast   391 YTMKNVQFLVTSFLTVVLFLRLVRSDPGCLKTDDSLTSIQETIKQLIDLGKFDRE---------- 445

  Fly   105 HFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTV----YMHIGSLLSL 165
            :||.......|.||.:.......:.|.||:|.:....||..|::.|.:|.|    :|.:...|.|
Yeast   446 NFCVETLERKPLRSKYSFFSGALVARYDHYCPWIYNDVGLKNHKLFVFFAVTVQYHMFLFMWLCL 510

  Fly   166 ATHVNLLIIDEQIRRQYVVLHF--------------SRFFLFLKPMSCELIALNISFIINIYACI 216
            |.......|.||: .:|.....              |.||||:. :|...|.|....|:..:.  
Yeast   511 AYFKKTNYIYEQV-EEYARCALLKNETLCKGSNYDPSTFFLFIW-ISVNFIWLGAMLIVQFFQ-- 571

  Fly   217 LSLIMLGYQIPALYL 231
               |:.|...|.|::
Yeast   572 ---ILKGITTPELFI 583

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 36/150 (24%)
AKR2NP_014677.1 ANKYR 1..195 CDD:223738
ANK repeat 54..81 CDD:293786
ANK repeat 83..115 CDD:293786
ANK repeat 117..148 CDD:293786
ANK repeat 189..220 CDD:293786
Ank_4 190..243 CDD:372654
ANK repeat 222..247 CDD:293786
COG5273 340..711 CDD:227598 44/210 (21%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.