DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and PFA4

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_014640.1 Gene:PFA4 / 854159 SGDID:S000005363 Length:378 Species:Saccharomyces cerevisiae


Alignment Length:332 Identity:82/332 - (24%)
Similarity:114/332 - (34%) Gaps:123/332 - (37%)


- Green bases have known domain annotations that are detailed below.


  Fly    38 FFSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLLGNMLACHRNSSAVTSLPKDRQIPCPEEKH 102
            :|.:..|..:|:         :|.:...|.:::  |...||...|...    |.....|.|:   
Yeast    28 YFILSNFLSVPK---------QITFEFCLSMIW--LSYYLAICTNPGR----PLPNYKPPPD--- 74

  Fly   103 LW-HFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNY----RYFFWFTVYMHIGSL 162
            :| :||..||...|.||.|||.|..|:|..||||.:|..|||..||    |:.||..|       
Yeast    75 IWRNFCKKCQSYKPERSHHCKTCNQCVLMMDHHCPWTMNCVGFANYPHFLRFLFWIIV------- 132

  Fly   163 LSLATHVNLLIIDEQIRRQYVV---LHFSRFFLFLKPMSCELIALNISFIINIYA---------- 214
               .|.|...|   |.:|.|.:   .|...:| |.|   .|||.|.||..:|.:.          
Yeast   133 ---TTSVLFCI---QAKRIYFIWQQRHLPGYF-FKK---SELIFLTISSPLNSFVLLTITILFLR 187

  Fly   215 CILSLIMLG-YQIPA------------------LYLNT--------TFYTPKD------------ 240
            |:.:.|:.| .||.:                  |..||        :|...||            
Yeast   188 CLFNQILNGRSQIESWDMDRLESLFNSGRLTQKLIDNTWRIYPESRSFQNKKDAEEHLTKKRPRF 252

  Fly   241 -----YRYNQGLLGNFMAFMGKRGLWTF-------------------------ISPSIRS-PLPH 274
                 :.|:..|..|.:.::|...||.:                         :...|.| |.|.
Yeast   253 DELVNFPYDFDLYTNALLYLGPIHLWLWPYGVPTGDGNNFPKNGISKYEANSSLEDHILSLPWPP 317

  Fly   275 DGTKWQT 281
            ||.|..|
Yeast   318 DGGKTNT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 53/180 (29%)
PFA4NP_014640.1 COG5273 1..344 CDD:227598 82/332 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.