DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and PFA5

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_010747.1 Gene:PFA5 / 852070 SGDID:S000002867 Length:374 Species:Saccharomyces cerevisiae


Alignment Length:297 Identity:63/297 - (21%)
Similarity:106/297 - (35%) Gaps:86/297 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    21 KIVHPSAVGFVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLLGNMLACH----- 80
            |.:...:|...|:..|.|..|.:.::               ||..:.:|    |.....|     
Yeast    45 KRLRQKSVSVGLICAVCFLDVVVIFI---------------WLQIVILV----GPGTQPHVAPFL 90

  Fly    81 ----------RNSSAVTSLPKDRQIP--C----PEEKHLWHFCDHCQMLVPPRSWHCKVCECCIL 129
                      .|:|..||:..|..:|  |    |....:|  |..||.|...|:.|......||.
Yeast    91 ILPIASEEKTSNTSQNTSVEYDAVVPPKCYQSDPHGYPIW--CSECQSLKMERTHHSSELGHCIP 153

  Fly   130 RRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLFL 194
            |.||:|::..|.:|..|||.|..|..|                              ||...|.:
Yeast   154 RFDHYCMWIGTVIGRDNYRLFVQFAAY------------------------------FSTLLLIM 188

  Fly   195 KPMSCELIAL----NISFIINIYACILSLI---MLGYQIPA-LYLNTTFYTPKDYRYNQGLLGNF 251
            ....|..|.:    |.::..|:.|.|:|.:   :||:.:.| |..::.||..::....:.::.:.
Yeast   189 WVSICVYIRIITQHNHNYSPNLNANIISTLVFAILGWLLTASLLASSIFYMSQNKTSLEAIIDSK 253

  Fly   252 MAFMGKRGLWTFISPS--IRSPLPHDGTK----WQTK 282
            ....|.|.::.:.|.:  :|..:..|.::    |..|
Yeast   254 RKKFGTRKIFCYYSEANKLRFVVEFDRSEFHSFWDKK 290

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 35/143 (24%)
PFA5NP_010747.1 COG5273 9..335 CDD:227598 63/297 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.