DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and zdhhc5b

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_009289570.1 Gene:zdhhc5b / 792560 ZFINID:ZDB-GENE-101117-1 Length:658 Species:Danio rerio


Alignment Length:264 Identity:65/264 - (24%)
Similarity:94/264 - (35%) Gaps:74/264 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 PKRFAKIVHPSAVGFVLVGTVLFFSV------EMFYMLPRIYDTDGLFFKIA-WLMALFIVYNLL 73
            |.|:..:  .:|..|::..|.||...      |.|.....:|:.....|.:| :.||.|:...:.
Zfish    22 PSRYVPV--SAATAFLVGATTLFLCFTCPWLSEKFSSFIPLYNVVVFLFTLANFCMATFMDPGVF 84

  Fly    74 GNMLACHRNSSAVTSLPKDRQIPCPEEKHL----------WHFCDHCQMLVPPRSWHCKVCECCI 128
                     ..|.....|:.....|..|.:          |  |..|:...|||..||.||:.|:
Zfish    85 ---------PRAEEDEDKEDDFRAPLYKTVEVRGIQVRMKW--CSTCRFYRPPRCSHCSVCDNCV 138

  Fly   129 LRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLF 193
            ...||||.:...|:|..||||||.|        ||||..|    |:|        |..||..::.
Zfish   139 EEFDHHCPWVNNCIGRRNYRYFFLF--------LLSLTVH----IMD--------VFGFSLLYIL 183

  Fly   194 LKPMSCELIALNISFIINIYACILSLIMLGYQIPALYLNTTFYTPKDYRYNQGLLGNFMAFMGKR 258
            ......:|:...::..:   .|:..|               |:.|.     .||.| |...:..|
Zfish   184 HHTKQLDLVQSGVTMAV---MCVAGL---------------FFVPV-----AGLTG-FHVVLVAR 224

  Fly   259 GLWT 262
            |..|
Zfish   225 GRTT 228

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 38/145 (26%)
zdhhc5bXP_009289570.1 DHHC 110..235 CDD:396215 46/165 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.