DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and Zdhhc4

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_082655.1 Gene:Zdhhc4 / 72881 MGIID:1920131 Length:343 Species:Mus musculus


Alignment Length:254 Identity:62/254 - (24%)
Similarity:103/254 - (40%) Gaps:59/254 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LFFKIAWLMALFIV--YNLLGNMLACHRNSSAVT--------SLPKDRQIPCPEEKHLWHFCDHC 110
            |.|.:.:|:..:::  .||:...|.|..|...:|        .:.|...:..|:...    |..|
Mouse    94 LEFSLPYLLLPYVLLSVNLVFFTLTCAANPGTITKANESFLLQVYKFDDVMFPKNSR----CPTC 154

  Fly   111 QMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLAT-----HVN 170
            .:..|.||.||::|:.|:.|.||||::...|:|..|.|||..:.:.: ..|..::||     .:.
Mouse   155 DLRKPARSKHCRLCDRCVHRFDHHCVWVNNCIGAWNTRYFLIYLLTL-TASAATIATVTAAFLLR 218

  Fly   171 LLIIDEQIRRQYV--VLHFSRF-------FLFLKPMSCELIALNISFIINIYACILSLIMLGYQI 226
            |:.:.:..:..|:  |.||...       .|||   :...|...:.|:|     :||:::.||..
Mouse   219 LVTVSDLYQETYLDDVGHFQAVDTVFLIQHLFL---AFPRIVFLLGFVI-----VLSMLLAGYLC 275

  Fly   227 PALYLNTTFYTPKDYRYNQGLLGNFMAFMGKRGLWTFISPSIRSPLPHDGTKWQTKQAP 285
            .||||..|..|..::               .:|.|.:..   |.||    ..|.....|
Mouse   276 FALYLAATNQTTNEW---------------YKGDWAWCQ---RWPL----VAWSPSAEP 312

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 43/149 (29%)
Zdhhc4NP_082655.1 DHHC 151..292 CDD:396215 44/164 (27%)
Di-lysine motif. /evidence=ECO:0000250|UniProtKB:Q9NPG8 340..343
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3877
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.760

Return to query results.
Submit another query.