DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and Zdhhc16

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_006231465.1 Gene:Zdhhc16 / 654495 RGDID:1591893 Length:377 Species:Rattus norvegicus


Alignment Length:311 Identity:77/311 - (24%)
Similarity:113/311 - (36%) Gaps:100/311 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLVGTVLFFSVEMFYMLP---RIYDTDGL---FFKIAW--LMALFIVYNLL---------GNMLA 78
            ||.|:::  ::....:||   |.|....|   ||...|  ::.:|..|..:         |    
  Rat    89 VLTGSIV--AIAYLCVLPLILRTYSVPRLCWHFFYSHWNLILIVFHYYQAITTPPGYPPQG---- 147

  Fly    79 CHRNSSAVTSLPKDRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVG 143
              ||..|..|:                 |..|....|.|:.||.:|..|:|:.||||.:...|||
  Rat   148 --RNDIATVSI-----------------CKKCIYPKPARTHHCSICNRCVLKMDHHCPWLNNCVG 193

  Fly   144 HTNYRYFFWFTVYMHIGSL-------------------LSLATHVNLLIIDEQIRRQYV------ 183
            |.|:||||.|..:|.:|.:                   :.......|..|..|...|..      
  Rat   194 HYNHRYFFSFCFFMTLGCVYCSYGSWDLFREAYAAIEKMKQLDKNKLQAIANQTYHQTPPPTFSF 258

  Fly   184 ---VLHFSRFFL-FLKPMSCELIALNISFIINIYACILSLIMLGYQIPALYLN-----------T 233
               :.|.|..:| ||    |..:||.:..:...:|.::|   .|......::|           .
  Rat   259 RERITHKSLVYLWFL----CSSVALALGALTMWHAVLIS---RGETSIERHINKKERRRLQAKGR 316

  Fly   234 TFYTPKDYRYNQGLLGNFMAFM----GKRGLWTFISPSIRSPLPH-DGTKW 279
            .|..|    ||.|.|.|:..|:    |:..|...:.||  |.||| :|..|
  Rat   317 VFRNP----YNYGCLDNWKVFLGVDTGRHWLTRVLLPS--SHLPHGNGMSW 361

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 41/175 (23%)
Zdhhc16XP_006231465.1 DHHC 156..305 CDD:396215 40/172 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.