DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and CG18810

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_652670.2 Gene:CG18810 / 59171 FlyBaseID:FBgn0042133 Length:300 Species:Drosophila melanogaster


Alignment Length:269 Identity:85/269 - (31%)
Similarity:129/269 - (47%) Gaps:34/269 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FVLVGTVLFFSVEMFYMLPRIYD--TDGLFFKIAWLMALFIVYNLLGNMLACHRNSSAVTSLPKD 92
            |:|.|....:.|.|..:||.:.|  :.|..|::  |:.||:..|::.|.:.|.....::......
  Fly    22 FILCGLPAIYYVLMEIILPELSDYWSPGYVFQL--LLGLFLFSNVMSNYVMCILVDPSIDPKLMK 84

  Fly    93 RQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYM 157
            .|:...:....||.||.|.:|.||||.||:.|..|:|.|||||.||..|:||.||||||:|.:|.
  Fly    85 NQLVRGQHSEDWHECDKCGILAPPRSRHCRKCGVCVLMRDHHCFFTGCCIGHENYRYFFYFLIYF 149

  Fly   158 HIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLFL----KPMSCELIALNISFII----NIYA 214
            .:..::|| |..::.|         .|||..|:.||:    .|.|....:|.|..|.    :||.
  Fly   150 FLSCMISL-TSSSIFI---------YVLHGGRYQLFMLTHPAPNSAYFNSLIIRIIYFKLPDIYE 204

  Fly   215 CILSLIMLGYQIPALYLNTTFYTP------------KDYRYNQGLLGNFMAFMGKRGLWTFISPS 267
            .:.:|:.:...|.........|..            ::..:::.|..||..|:|:|..||:||..
  Fly   205 LVFTLVFVLLWIGVCVATYVAYDQWSRGYFCYDFELQNIPFDRKLRRNFKTFLGRRMKWTWISGF 269

  Fly   268 IRSPLPHDG 276
            :.|.|.|||
  Fly   270 VPSQLDHDG 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 52/143 (36%)
CG18810NP_652670.2 zf-DHHC 92..>138 CDD:303066 25/45 (56%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467569
Domainoid 1 1.000 92 1.000 Domainoid score I7574
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4533
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
98.900

Return to query results.
Submit another query.