DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and zdhhc5a

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_005160301.1 Gene:zdhhc5a / 571795 ZFINID:ZDB-GENE-090312-92 Length:760 Species:Danio rerio


Alignment Length:174 Identity:54/174 - (31%)
Similarity:71/174 - (40%) Gaps:37/174 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ANPKRFAKIVHPSAVGFVLVG-TVLFFSV------EMFYMLPRIYDTDGLFFKIA-WLMALFIVY 70
            :.|.|.::.|..||....||| |.|||..      |.|.:...||:.....|.:| :.||.|:..
Zfish    23 SRPLRPSRYVPVSAATAFLVGSTTLFFCFTCPWLSEQFSVAVPIYNGVMFMFVLANFCMATFMDP 87

  Fly    71 NLLGNMLACHRNSSAVTSLPKDRQIPCPEEKHL----------WHFCDHCQMLVPPRSWHCKVCE 125
            .:.         ..|.....|:.....|..|.:          |  |..|:...|||..||.||:
Zfish    88 GIF---------PRAEEDEDKEDDFRAPLYKTVEIRGIQVRMKW--CSTCRFYRPPRCSHCSVCD 141

  Fly   126 CCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHV 169
            .|:...||||.:...|:|..||||||.|        ||||..|:
Zfish   142 NCVEDFDHHCPWVNNCIGRRNYRYFFLF--------LLSLTAHI 177

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 30/80 (38%)
zdhhc5aXP_005160301.1 zf-DHHC 116..241 CDD:279823 29/72 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.