DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and zdhhc14

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001038652.1 Gene:zdhhc14 / 569667 ZFINID:ZDB-GENE-040724-21 Length:513 Species:Danio rerio


Alignment Length:331 Identity:74/331 - (22%)
Similarity:124/331 - (37%) Gaps:97/331 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    23 VHPSAVGFVLVGTVLFF-SVEMFYM-LPRIYDTDGLFF----------------KIAWLMALFIV 69
            |.|....|...|.::.. ...:||: :..|..|.||||                .|..::.:|: 
Zfish    41 VFPGRNRFYCNGRIMMAKQTGVFYLTMVLILVTSGLFFAFDCPFLASNLTPAIPAIGGVLFVFV- 104

  Fly    70 YNLLGNMLACHRNSSAVTSLPK---------DRQI------------PCPEEKHL--------WH 105
               :|.:|....:...|  ||:         :|||            |.|..:.:        ..
Zfish   105 ---MGMLLRASFSDPGV--LPRATPEEAADIERQIDANNGPSGPGYRPPPRTREVLINGQTVKLK 164

  Fly   106 FCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLA---T 167
            :|..|::..|||:.||.:|:.|:.|.||||.:...|||..|||:|:.|.:.:...::...|   |
Zfish   165 YCFTCKIFRPPRASHCSLCDNCVDRFDHHCPWVGNCVGRRNYRFFYLFILSLSFLTIFIFAFVIT 229

  Fly   168 HVNLLIIDEQIRRQYVVLHFSRFFLFLK-PMSCELIALN---ISFIINIYACILSLIML----GY 224
            ||.|    ..:|:...:...:.|....| |.....:.|:   :..::.:..|..|:..:    |:
Zfish   230 HVIL----NALRKALALSTAADFEAVQKDPTGLAFLVLSKTALLDVLEVVVCFFSVWSIVGLSGF 290

  Fly   225 QIPALYLNTTFYTPKDYR-----------YNQGLLGNFM-------------AFMGKRGLWTFIS 265
            ....:..|.|  |.:|.:           ||....|||:             :.:.:||   ||.
Zfish   291 HTYLISSNQT--TNEDIKGSWSSKRGKGNYNPYSYGNFITNCCSALCGPLPPSLIDRRG---FIQ 350

  Fly   266 PSIRSP 271
            |....|
Zfish   351 PDTPQP 356

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 37/154 (24%)
zdhhc14NP_001038652.1 zf-DHHC 163..306 CDD:279823 39/148 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 348..369 4/9 (44%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.