DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and zdhhc20a

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_005172729.1 Gene:zdhhc20a / 561776 ZFINID:ZDB-GENE-070424-38 Length:369 Species:Danio rerio


Alignment Length:244 Identity:53/244 - (21%)
Similarity:89/244 - (36%) Gaps:72/244 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    28 VGFVLVGTVLFFSVEM-FYMLPRIYDT-------DGLFFKIAWLMALFIVYNLLGNMLACHRNSS 84
            :..|:..:...:.||: .|.:|.:.:.       ...||...|.....|              ||
Zfish    22 INLVVCWSYYAYVVELCIYTIPNVNEQVIYLVVFHAFFFMFMWSYWKTI--------------SS 72

  Fly    85 AVTSLPKDRQIPCPEEKHLW-------------------------------HFCDHCQMLVPPRS 118
            ..|:..|:..:| ..||.|:                               .:||.||::.|.|.
Zfish    73 KPTNPSKEFCLP-KAEKELYEKEERPEAQQDILKRVARELPIYTFTGSGAIRYCDRCQLIKPDRC 136

  Fly   119 WHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYV 183
            .||..|:.|:|:.||||.:...|||.:||::|..|..|..:..:...||.:...|....:.|:..
Zfish   137 HHCSTCDKCVLKMDHHCPWVNNCVGFSNYKFFVLFLAYSMLYCVYIAATVLQYFIKFWTLCRRRA 201

  Fly   184 VLH------------FSRFFLFLKPMSCELIALNISFIINIYACILSLI 220
            :.|            |...|||.      :.|:....|:::::..|.|:
Zfish   202 IEHCPENQLPDTHAKFHVLFLFF------VAAMFFISILSLFSYHLWLV 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 39/164 (24%)
zdhhc20aXP_005172729.1 zf-DHHC 12..309 CDD:303066 53/244 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.