DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and zdhhc9

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001103496.1 Gene:zdhhc9 / 560095 ZFINID:ZDB-GENE-071004-8 Length:382 Species:Danio rerio


Alignment Length:285 Identity:69/285 - (24%)
Similarity:112/285 - (39%) Gaps:91/285 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FVLVGTV-LFFSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLL-------------------- 73
            |::|||. |||:.|..|:...:.....:|   |.|:.:|::..||                    
Zfish    39 FLIVGTCSLFFAFECPYLAVHLSPAIPVF---AVLLFVFVMAMLLRTSFSDPGVLPRALPEEANF 100

  Fly    74 ---------GNMLACHRNSSAVTSLPKDRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCIL 129
                     ||:||..|....:.::..:.||.      ...:|..|::..|||:.||.:|:.|:.
Zfish   101 IEMEIEAANGNVLAGQRPPPRIKNVQINNQIV------KLKYCYTCKIFRPPRASHCSICDNCVD 159

  Fly   130 RRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSL------ATHVNLLIIDEQIRRQYVVLHFS 188
            |.||||.:...|||..|||||:.||:.:   |||::      ..||.|..:|            |
Zfish   160 RFDHHCPWVGNCVGKRNYRYFYLFTLSL---SLLTIYIFAFDIVHVVLRSVD------------S 209

  Fly   189 RFFLFLKPMSCELIALNISFIINIYACILSLI----MLGYQIPALYLNTTFYTPKDYRYNQGLLG 249
            .|...||...        ..::.:..|..:|.    :.|:....:.||.|        .|:.:.|
Zfish   210 GFVNTLKETP--------GTVLEVLVCFFTLWSVVGLTGFHTYLISLNQT--------TNEDIKG 258

  Fly   250 NFMAFMGKRGLWTFISPSIRSPLPH 274
               ::.||.        .:::|..|
Zfish   259 ---SWSGKN--------RVQNPYSH 272

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 41/145 (28%)
zdhhc9NP_001103496.1 zf-DHHC 134..257 CDD:279823 42/153 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.