DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and ZDHHC4

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001358221.1 Gene:ZDHHC4 / 55146 HGNCID:18471 Length:359 Species:Homo sapiens


Alignment Length:272 Identity:64/272 - (23%)
Similarity:95/272 - (34%) Gaps:97/272 - (35%)


- Green bases have known domain annotations that are detailed below.


  Fly    66 LFIVYNLLG-NM----LACHRNSSAVTSLPKDRQIPCPEEKHLWHF----------CDHCQMLVP 115
            |.:.|.||| |:    |.|..|...:|...:...:      |::.|          |..|.:..|
Human   101 LLLPYLLLGVNLFFFTLTCGTNPGIITKANELLFL------HVYEFDEVMFPKNVRCSTCDLRKP 159

  Fly   116 PRSWHCK---------------VCECCILRRDHHCIFTATCVGHTNYRYFF-------------- 151
            .||.||.               ||..|:.|.||||::...|:|..|.|||.              
Human   160 ARSKHCSECGSRDSSGTSNSTCVCNWCVHRFDHHCVWVNNCIGAWNIRYFLIYVLTLTASAATVA 224

  Fly   152 ----WFTVYMHIGSLLSLATHV----NLLIIDEQIRRQYVVLHFSRFFLFLKPMSCELIALNISF 208
                .|.|::.:.|.|...|::    :|.::|.....||:.|.|.|            |...:.|
Human   225 IVSTTFLVHLVVMSDLYQETYIDDLGHLHVMDTVFLIQYLFLTFPR------------IVFMLGF 277

  Fly   209 IINIYACILSLIMLGYQIPALYLNTTFYTPKDYRYNQGLLGNFMAFMGKRGLWTFISPSIRSPLP 273
            ::     :||.::.||.:..|||..|..|..::               .||.|.:..   |.|| 
Human   278 VV-----VLSFLLGGYLLFVLYLAATNQTTNEW---------------YRGDWAWCQ---RCPL- 318

  Fly   274 HDGTKWQTKQAP 285
               ..|.....|
Human   319 ---VAWPPSAEP 327

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 45/182 (25%)
ZDHHC4NP_001358221.1 DHHC 151..307 CDD:366691 44/187 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 1 0.950 - 0 Normalized mean entropy S3877
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.860

Return to query results.
Submit another query.