Sequence 1: | NP_648928.1 | Gene: | CG13029 / 39886 | FlyBaseID: | FBgn0036670 | Length: | 288 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_001358221.1 | Gene: | ZDHHC4 / 55146 | HGNCID: | 18471 | Length: | 359 | Species: | Homo sapiens |
Alignment Length: | 272 | Identity: | 64/272 - (23%) |
---|---|---|---|
Similarity: | 95/272 - (34%) | Gaps: | 97/272 - (35%) |
- Green bases have known domain annotations that are detailed below.
Fly 66 LFIVYNLLG-NM----LACHRNSSAVTSLPKDRQIPCPEEKHLWHF----------CDHCQMLVP 115
Fly 116 PRSWHCK---------------VCECCILRRDHHCIFTATCVGHTNYRYFF-------------- 151
Fly 152 ----WFTVYMHIGSLLSLATHV----NLLIIDEQIRRQYVVLHFSRFFLFLKPMSCELIALNISF 208
Fly 209 IINIYACILSLIMLGYQIPALYLNTTFYTPKDYRYNQGLLGNFMAFMGKRGLWTFISPSIRSPLP 273
Fly 274 HDGTKWQTKQAP 285 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
CG13029 | NP_648928.1 | zf-DHHC | 100..236 | CDD:279823 | 45/182 (25%) |
ZDHHC4 | NP_001358221.1 | DHHC | 151..307 | CDD:366691 | 44/187 (24%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 0 | 0.000 | Not matched by this tool. | |||
Domainoid | 0 | 0.000 | Not matched by this tool. | |||
eggNOG | 0 | 0.000 | Not matched by this tool. | |||
Hieranoid | 0 | 0.000 | Not matched by this tool. | |||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 0 | 0.000 | Not matched by this tool. | |||
Isobase | 1 | 0.950 | - | 0 | Normalized mean entropy | S3877 |
OMA | 0 | 0.000 | Not matched by this tool. | |||
OrthoDB | 0 | 0.000 | Not matched by this tool. | |||
OrthoFinder | 0 | 0.000 | Not matched by this tool. | |||
OrthoInspector | 0 | 0.000 | Not matched by this tool. | |||
orthoMCL | 0 | 0.000 | Not matched by this tool. | |||
Panther | 0 | 0.000 | Not matched by this tool. | |||
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 0 | 0.000 | Not matched by this tool. | |||
SonicParanoid | 0 | 0.000 | Not matched by this tool. | |||
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 0 | 0.000 | Not matched by this tool. | |||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
2 | 1.860 |