DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and ZDHHC3

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_016862050.1 Gene:ZDHHC3 / 51304 HGNCID:18470 Length:378 Species:Homo sapiens


Alignment Length:390 Identity:84/390 - (21%)
Similarity:126/390 - (32%) Gaps:144/390 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MMIGCKYIANANPK----RFAKIVHPSAVGFVLVGTVLFFSVEMFYMLPRIYDTDGLFFKI-AWL 63
            |:|...:..|...|    :..|.|.|...|  .|||:.|           |.|..|:...| .|.
Human     2 MLIPTHHFRNIERKPEYLQPEKCVPPPYPG--PVGTMWF-----------IRDGCGIACAIVTWF 53

  Fly    64 MALF-----------------------IVYNLLGNM-LACHRNSSAVT--SLPKDR--------- 93
            :.|:                       ||:|||..: ||.|..:....  ::||..         
Human    54 LVLYAEFVVLFVMLIPSRDYVYSIINGIVFNLLAFLALASHCRAMLTDPGAVPKGNATKEFIESL 118

  Fly    94 QIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMH 158
            |:   :...:.:.|..|..:.|.|:.||.||:.||.:.||||.:...|||..|.:||..||:|: 
Human   119 QL---KPGQVVYKCPKCCSIKPDRAHHCSVCKRCIRKMDHHCPWVNNCVGENNQKYFVLFTMYI- 179

  Fly   159 IGSLLSLATHVNLLI-----------------IDEQIRRQYVVLHFSRFFLFLKPMSCELIALNI 206
              :|:||  |..:::                 ..|::....:.||.....|......|...:...
Human   180 --ALISL--HALIMVGFHFLHCFEEDWTTYGLNREEMAETGISLHEKMQPLNFSSTECSSFSPPT 240

  Fly   207 SFIINIYAC-------ILSLIMLGYQI-----------------------------------PAL 229
            :.|:.|..|       |.:.:|.|.|:                                   |.|
Human   241 TVILLILLCFEGLLFLIFTSVMFGTQVHSICTDETKRWRKQCPQWRVKGLCAGCCGPGELAWPCL 305

  Fly   230 YL-------NTT---------------FYTPKDYRYNQGLLGNFMAFMGKRGLWTFISPSIRSPL 272
            ||       ||.               ...|:.....||..|...  :.|..||..:.|.:..||
Human   306 YLLWASPHPNTLSVAWWLSCSRHPEAGHRAPQTKEPAQGAHGELA--VSKGDLWWGLLPELVQPL 368

  Fly   273  272
            Human   369  368

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 45/216 (21%)
ZDHHC3XP_016862050.1 None


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.