DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and Zdhhc14

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001034432.1 Gene:Zdhhc14 / 499014 RGDID:1565877 Length:489 Species:Rattus norvegicus


Alignment Length:308 Identity:75/308 - (24%)
Similarity:116/308 - (37%) Gaps:97/308 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLVGTVLFFSVEMFYM----LPRIYDTDGLFFKIAWLMALFIVYNLLGNMLACHRNSSAVTSLPK 91
            :||.:.|||:.:..|:    .|.|....|:.|           :.::|.:|....:...|  ||:
  Rat    71 ILVTSGLFFAFDCRYLAEKITPAIPVVGGILF-----------FFVMGTLLRTSFSDPGV--LPR 122

  Fly    92 ---------DRQI------------PCPEEKHL--------WHFCDHCQMLVPPRSWHCKVCECC 127
                     :|||            |.|..|.:        ..:|..|::..|||:.||.:|:.|
  Rat   123 ATPDEAADLERQIDIANGTSSGGYRPPPRTKEVIINGQTVKLKYCFTCKIFRPPRASHCSLCDNC 187

  Fly   128 ILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSR--- 189
            :.:.||||.:...|||..|||:|     ||.|.||..|...:...:|..       |:|.|:   
  Rat   188 VEQFDHHCPWVGNCVGKRNYRFF-----YMFILSLSFLTVFIFAFVITH-------VIHRSQQKG 240

  Fly   190 FFLFLKPMSCELIALNISFIINIYACILSLIML-GYQIPALYLNTTFYTPKDYR----------- 242
            |...||.....::...|.|.     .:.|:|.| |:....:..|.|  |.:|.:           
  Rat   241 FLDALKDSPASVLEAVICFF-----SVWSIIGLSGFHTYLISSNQT--TNEDIKGSWSNKRGKEN 298

  Fly   243 YNQGLLGNFM-------------AFMGKRGLWTFISPSIRSP-LPHDG 276
            ||....||..             :.:.:||   :|.|....| .|.:|
  Rat   299 YNPYSYGNIFTNCCVALCGPISPSLIDRRG---YIQPDTPQPAAPSNG 343

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 42/147 (29%)
Zdhhc14NP_001034432.1 DHHC 164..287 CDD:396215 43/141 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.