DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and zdhhc23b

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001003757.1 Gene:zdhhc23b / 445301 ZFINID:ZDB-GENE-040808-13 Length:425 Species:Danio rerio


Alignment Length:290 Identity:68/290 - (23%)
Similarity:114/290 - (39%) Gaps:82/290 - (28%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VGTVLFFSVEMFYM-----LPRIYDTDGLFFKIAWLMALFIVYNLL---GNMLACHRNS---SAV 86
            :|..||....|||:     :||...|:.....:...:||.:::.:|   |..|...|.|   |.|
Zfish   134 LGLALFSLFYMFYLFLTQVVPRGEVTELQLAVVTAGVALTVIFLMLTKRGPGLVRPRPSETHSTV 198

  Fly    87 T--SLPKD----------RQI--------------PCPEE------KHLWHFCDHCQMLVPPRSW 119
            |  |.|.|          .|:              |..||      |..|  |..|:::.|.|:.
Zfish   199 TYHSTPPDVDGVYLNGARHQVVIGSRVASSEHTGEPGTEEEEEGVQKRNW--CAVCKVVRPRRAG 261

  Fly   120 HCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVV 184
            ||::|..|:||.||||::..:|||..|:|.|....::..:.|:..::..:..:..|:::...   
Zfish   262 HCRICGVCVLRLDHHCVWINSCVGLANHRTFLLTLLFFLLTSIFGISLVLASVCPDQRVLTA--- 323

  Fly   185 LHFSRFFLFLKPMSCELIALNISFIINIYACILS---LIMLGYQIPALYLNTTFYTPKDYR---- 242
                   ||..|......:..:.|....|:.|::   |.:|..||..:.||.   |.::.|    
Zfish   324 -------LFYCPDVYSQYSSALCFTCAWYSSIVTGGLLHLLLLQILNISLNV---TEREARLALR 378

  Fly   243 -----------------YNQGLLGNFMAFM 255
                             |::|...|:..|:
Zfish   379 EKSAQRRLWGLIVHTGHYSRGFWSNWTEFL 408

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 37/144 (26%)
zdhhc23bNP_001003757.1 7TMR-DISM_7TM <62..179 CDD:284997 11/44 (25%)
zf-DHHC <244..>350 CDD:303066 30/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.