DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and CG5880

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651539.3 Gene:CG5880 / 43268 FlyBaseID:FBgn0039489 Length:381 Species:Drosophila melanogaster


Alignment Length:339 Identity:77/339 - (22%)
Similarity:116/339 - (34%) Gaps:130/339 - (38%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FVLVG----TVLFFSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLL--GNML----ACHRNSS 84
            |.:||    |....|:..:..||        |:   |..:..:.|.||  ||.|    ..|...:
  Fly    65 FFVVGVAALTTSVVSIAYWIGLP--------FW---WAKSQLVTYFLLIVGNWLLLNVVFHYVMA 118

  Fly    85 AVTSLPKDRQIPC---PEEKHLWH---FCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVG 143
            .:|        |.   ||...|..   .|..|....|||:.||.:|..|||:.||||.:...|||
  Fly   119 VIT--------PAGHPPEGVSLVEAVSMCGKCIAPKPPRTHHCSICNRCILKMDHHCPWLNNCVG 175

  Fly   144 HTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLFLKPMSCELIALNIS- 207
            :.|:||||.:..|..:|.|.       |::...:|..:|:.|.....:..::|:..:.:..|:| 
  Fly   176 YGNHRYFFLYMTYTTLGCLF-------LILFGLEIGHKYLWLDHGENWTEIEPLEGQPVKFNLSG 233

  Fly   208 -------------FII-------------------------------NIYACILSLIMLG----- 223
                         |::                               |: |.:|:|..|.     
  Fly   234 HIIPVTHPNEYDEFVLPPAVHNLPTPIVDTDAASPGRRRALWFMAFTNV-AVVLALGSLSIWHAK 297

  Fly   224 ---------------------YQIPALYLNTTFYTPKDYRYNQGLLGNFMAFMG---KRGLW-TF 263
                                 .|...:|:|.         ||.|...|:..|:|   .|..| |.
  Fly   298 LITRGETSVEAHINEAERKRHLQQQRIYINP---------YNFGTKKNWKLFLGLVRGRSFWRTV 353

  Fly   264 ISPSIRSPLPHDGT 277
            :.||...|   :||
  Fly   354 LLPSWHKP---EGT 364

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 43/209 (21%)
CG5880NP_651539.3 zf-DHHC 139..>201 CDD:279823 27/68 (40%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.