DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and CG4956

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651428.2 Gene:CG4956 / 43114 FlyBaseID:FBgn0039370 Length:302 Species:Drosophila melanogaster


Alignment Length:282 Identity:107/282 - (37%)
Similarity:148/282 - (52%) Gaps:41/282 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVHPSAVGFVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLLGN-MLACHRNSSA 85
            ::||....|:|....|.|..|:.|:||:|.|..|::.|:.|.|.::.|.|:||| .|.|..|:| 
  Fly    40 LLHPFCAIFLLCLIGLLFVYELCYVLPQITDPHGIWHKLCWFMGIYTVINILGNWWLGCMTNTS- 103

  Fly    86 VTSLPKDRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYF 150
            |.||..:||.|...|.||||:|..||.|||||||||.:|..|||:|||||.|.|:|:||.|.|||
  Fly   104 VDSLVLERQYPVAGEAHLWHYCSTCQKLVPPRSWHCSLCNICILKRDHHCTFFASCIGHKNQRYF 168

  Fly   151 FWFTVYMHIGSLLSLA-------THVNLLII------------DEQIRRQYVVLHFSRFFLFLKP 196
            ..|..::..||..:|.       |:...|::            |...:.:|.:.:..:..|||  
  Fly   169 LAFLFHLSFGSGQALVYNGILNWTNKAFLVVDPLLLMFQDTTQDADFKWKYTIANLFKLNLFL-- 231

  Fly   197 MSCELIALNISFIINIYACILSLIMLGYQIPALYLNTTFYTPKDYRYNQGLLGNFMAFMGKRGLW 261
                       |.:.::..:..:||       :|.|:|.|...|..|:.|...||...:|||..|
  Fly   232 -----------FGVPLFMFVFQMIM-------VYRNSTCYKMLDRSYDVGWRRNFDMVLGKRRFW 278

  Fly   262 TFISPSIRSPLPHDGTKWQTKQ 283
            .|.||:|.||||.|||:|..||
  Fly   279 IFFSPTISSPLPTDGTQWFQKQ 300

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 52/154 (34%)
CG4956NP_651428.2 zf-DHHC 123..251 CDD:279823 47/147 (32%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469541
Domainoid 1 1.000 76 1.000 Domainoid score I5810
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4533
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
109.900

Return to query results.
Submit another query.