DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and CG17195

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_651427.2 Gene:CG17195 / 43113 FlyBaseID:FBgn0039369 Length:283 Species:Drosophila melanogaster


Alignment Length:296 Identity:130/296 - (43%)
Similarity:178/296 - (60%) Gaps:26/296 - (8%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MCFMMIGCKYIANANPKRFAKIVHPSAVGFVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWLMA 65
            ||::...|.|.||..||.|.:||||.::.|||..|..|||::|||:.|:::  ..:.:|:.|::.
  Fly     1 MCYVNRFCHYFANRYPKNFVRIVHPLSIVFVLCSTAFFFSLQMFYIAPKVF--GDIAYKLYWILV 63

  Fly    66 LFIVYNLLGNMLACHRNSSAVTSLPKDRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCILR 130
            .||.:|:|||||||:..||:|.:|.||.:.|.||::.|||:|:.|:.|..||||||.:|..||||
  Fly    64 TFITHNILGNMLACYMTSSSVNTLSKDSRCPNPEDEPLWHYCESCKKLRSPRSWHCVLCNTCILR 128

  Fly   131 RDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLFLK 195
            ||||||||.||:||.|.|:|||||.|:.:|.:.|.||..            ..:|.....|:.|.
  Fly   129 RDHHCIFTGTCIGHNNQRFFFWFTFYLTLGLVTSFATFC------------MFILQNGGNFMSLS 181

  Fly   196 PMSCELIAL------------NISFIINIYACILSLIMLGYQIPALYLNTTFYTPKDYRYNQGLL 248
            .:...||..            .|:|::||.|..:...||.||:..|..|:|:|...|..|:.|..
  Fly   182 SVIFNLITRTFFQNYTGNTFETIAFLLNISASYMPAFMLAYQMQILSQNSTYYNIFDCTYDLGFR 246

  Fly   249 GNFMAFMGKRGLWTFISPSIRSPLPHDGTKWQTKQA 284
            .|....||:|||||||||.::|||||||..||.||:
  Fly   247 KNCQTIMGQRGLWTFISPLLKSPLPHDGAHWQMKQS 282

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 58/147 (39%)
CG17195NP_651427.2 zf-DHHC 103..234 CDD:279823 56/142 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469533
Domainoid 1 1.000 76 1.000 Domainoid score I5810
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I3587
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
109.900

Return to query results.
Submit another query.