DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and CG17198

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001287532.1 Gene:CG17198 / 43110 FlyBaseID:FBgn0039366 Length:299 Species:Drosophila melanogaster


Alignment Length:258 Identity:99/258 - (38%)
Similarity:149/258 - (57%) Gaps:17/258 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 VLFFSVEMFYMLPRIYDTDGLFFK-IAWLMALFIVYNLLGNMLACHRNSSAVTSLPKDRQIPCPE 99
            :.|:..|.||::|:..   |||.: :.:|:..:||||:|.|:..|....:.|.|||...|.|...
  Fly    49 LFFYFFEAFYVMPQFL---GLFGQAVHFLVTTWIVYNILENLRLCVTTLNTVDSLPPQMQQPMKG 110

  Fly   100 EKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLS 164
            |:||||||..||..||||||||.:|:.|||:|||||.|...||||.|.|||.||:.|..|||.::
  Fly   111 EEHLWHFCKICQRNVPPRSWHCNICDACILKRDHHCNFVGNCVGHNNQRYFIWFSFYAAIGSAVA 175

  Fly   165 L-----ATHVNLLIIDEQIRRQYVVLHFSRFFLFLKPMSCELIALN--ISFI-INIYACILSLIM 221
            |     ..|.:.:...:.::..|::     |..::.|...||:...  :|.: :||:|.:....:
  Fly   176 LFDNFMLAHKHGVGFFDLVKANYII-----FNAYMNPGRKELVIFYRIVSVLGVNIFAVLFPAAL 235

  Fly   222 LGYQIPALYLNTTFYTPKDYRYNQGLLGNFMAFMGKRGLWTFISPSIRSPLPHDGTKWQTKQA 284
            ...|:..:..|:..:...|..|:.||..|....:|.|.|||.:||:|:|||||:||:|::|:|
  Fly   236 FCTQVVTVIKNSVMHDYSDRTYDLGLGNNLTLILGSRRLWTCLSPNIKSPLPHNGTRWKSKRA 298

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 54/143 (38%)
CG17198NP_001287532.1 zf-DHHC 43..>176 CDD:303066 63/129 (49%)
zf-DHHC 111..252 CDD:279823 54/145 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469537
Domainoid 1 1.000 76 1.000 Domainoid score I5810
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 99 1.000 Inparanoid score I3587
Isobase 1 0.950 - 0 Normalized mean entropy S3877
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
109.840

Return to query results.
Submit another query.