DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and app

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_648561.2 Gene:app / 39399 FlyBaseID:FBgn0260941 Length:755 Species:Drosophila melanogaster


Alignment Length:266 Identity:66/266 - (24%)
Similarity:113/266 - (42%) Gaps:55/266 - (20%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FMMIGCKYIANA-NPKRFAKIVHPSAVGFVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWLMAL 66
            |....|.::|:: ||            ...:||.||:| ..|..:|...:...|:..:.:...|.
  Fly    60 FFAFDCPFLADSINP------------AIPIVGAVLYF-FTMSSLLRTTFTDPGVIPRASNDEAA 111

  Fly    67 FIVYNL-LGNMLACHRNSSAVTSLPKDRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCILR 130
            :|...: :.|.|    ||......|:.:::....:.....:|..|::..|||:.||.:|:.|:.|
  Fly   112 YIEKQIEVPNSL----NSPTYRPPPRTKEVLVKGQTVKLKYCFTCKIFRPPRASHCSLCDNCVDR 172

  Fly   131 RDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLA--------THVNLLIIDEQIRRQYVVLHF 187
            .||||.:...|||..|||:|:.|.|     ||..||        ||:.||     :::::.|.:.
  Fly   173 FDHHCPWVGNCVGKRNYRFFYLFLV-----SLAFLAVFIFSCSVTHLVLL-----MKKEHEVFNV 227

  Fly   188 SRFFLFLKPMSCELIALNISFIINIYACILSLIMLGYQIPALYLNTTFYTPKDYRYNQGLLGNFM 252
            .:...|.              :|.::.|..|:    :.:..|....|:.|..|...|:.|.|:|.
  Fly   228 IKAAPFT--------------VIVVFICFFSI----WSVIGLAGFHTYLTTSDQTTNEDLKGSFS 274

  Fly   253 AFMGKR 258
            :..|.|
  Fly   275 SKGGPR 280

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 38/143 (27%)
appNP_648561.2 zf-DHHC 146..270 CDD:279823 41/151 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467549
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.