DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and CG4483

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_648294.1 Gene:CG4483 / 39057 FlyBaseID:FBgn0035970 Length:435 Species:Drosophila melanogaster


Alignment Length:255 Identity:55/255 - (21%)
Similarity:98/255 - (38%) Gaps:64/255 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 LFFKIAWLMALFIVYNLLGNMLACHRNSSAVTSLPKDRQIPCPEEKHLWHFCDHCQMLVPPRSWH 120
            |.:.:.|:.....:||.:.:::.    ......|....|:  .::|....||..|.....|||.|
  Fly    49 LNYALIWIQTFGTLYNFIRSLMV----GPGFVPLKWHPQL--TKDKMFLQFCTRCNGYKAPRSHH 107

  Fly   121 CKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIR------ 179
            |:.|..|:::.||||.:..||||.:|...|.:|.::...||:     |..::|:...||      
  Fly   108 CRRCNRCVMKMDHHCPWINTCVGWSNQDSFVYFLLFFMSGSI-----HGGIIIVSAVIRGIKKRW 167

  Fly   180 ------RQYVVLHFSRFFLFLKPMSCELIALNISFIINIYACILSL-IMLGYQIPALYLNTTFYT 237
                  |....:|.::                    .|:.||:.|| :::|..:.::.|  .:..
  Fly   168 LIRYGLRHMATVHLTQ--------------------TNLLACVFSLGVIMGTVLASIKL--LYMQ 210

  Fly   238 PKDYRYNQGLLGNFMAFMGKRGLWTFISPSIRSPLPHDGTK---------WQTKQAPTTF 288
            .|....||..:.|::.   |:..:.      |:..|..|.|         |:|......|
  Fly   211 MKSILKNQTEIENWIV---KKAAFR------RNAYPRKGIKPFVYPYNLGWKTNMREVFF 261

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 37/148 (25%)
CG4483NP_648294.1 zf-DHHC 88..224 CDD:279823 40/162 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467520
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.