DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and CG17287

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_611197.1 Gene:CG17287 / 36939 FlyBaseID:FBgn0034202 Length:338 Species:Drosophila melanogaster


Alignment Length:299 Identity:64/299 - (21%)
Similarity:106/299 - (35%) Gaps:94/299 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLLGNMLACHRNSSAVTSLPKDRQ 94
            ::.:|.:|||...:.:|           |...|...:|:                |...:|...:
  Fly    47 YLTIGLLLFFYHLLLFM-----------FLWTWFRCIFV----------------APVRIPDQWK 84

  Fly    95 IPCPEE-------------------------------KHLWHFCDHCQMLVPPRSWHCKVCECCI 128
            | .||:                               ..|..:|..|.::.|.|:.||:.|..|:
  Fly    85 I-SPEDVDKLKRNDGIEGASRVLNYAARNLPIATCTIDGLVRYCKTCWIIKPDRAHHCRTCHMCV 148

  Fly   129 LRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGS--LLSLATHVNLLIIDEQIRR----------Q 181
            |:.||||.:...||...|::||..|..|..:..  |..:..:...||...::..          |
  Fly   149 LKMDHHCPWIVNCVHFHNFKYFILFLFYAEVYCFYLFCVMVYDLYLICGFEVTALKNQHSWNILQ 213

  Fly   182 YVV-LHFSRFFLFLKPMSCELIALNISFIINIYACILSLIMLGYQIPALYLNTTFYTPKDYRYNQ 245
            |:| :.|:.|.:.:..:|...::.|.:.:.:.||   :..:||.:             .:..:|.
  Fly   214 YLVCILFNIFTVIMYTVSLLNVSRNRTTMESAYA---TYFLLGGK-------------NNNGFNL 262

  Fly   246 GLLGNFMAFMG-KRGLWTFISPSIRS-----PLPHDGTK 278
            |...||....| |..||.|...|.|.     ||.||..|
  Fly   263 GYFVNFRDLYGDKWYLWPFPIFSSRGDGFSFPLAHDRLK 301

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 35/179 (20%)
CG17287NP_611197.1 zf-DHHC 125..243 CDD:279823 30/117 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467492
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.