DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and CG4676

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_610853.1 Gene:CG4676 / 36465 FlyBaseID:FBgn0033815 Length:284 Species:Drosophila melanogaster


Alignment Length:299 Identity:100/299 - (33%)
Similarity:147/299 - (49%) Gaps:64/299 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly     2 CFMMIGCKYIANANPKRFAKIVHPSAVGFVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWLMAL 66
            ||:::.                       |.|.....|.|.:  ::|.::...|:::.:.||.:|
  Fly    20 CFLLVA-----------------------VFVPVTYIFHVTI--VMPELFAIGGIWYTLLWLASL 59

  Fly    67 FIVYNLLGNMLACHRNSSAVTSLPKDRQIPCPEEKHL--WHFCDHCQMLVPPRSWHCKVCECCIL 129
            |:::|:..|||||   ....||:.|:...|..:...|  ||.|..||.|||||||||:||..|:|
  Fly    60 FLIFNITSNMLAC---MLVDTSIRKELLKPPLDAAQLARWHSCQDCQTLVPPRSWHCEVCNVCVL 121

  Fly   130 RRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVL----HFSRF 190
            :|||||.||..|:||.||||||::.|||.||||.:        .|.|.|...::.|    .:|..
  Fly   122 KRDHHCRFTCCCIGHHNYRYFFYYLVYMIIGSLAA--------AIMESIYLWHLHLDIYWRWSTL 178

  Fly   191 FLFLKPMSCELIALNISFII-----NIYACILSLIMLGYQIPALYLNTTFYTPKD---------Y 241
            |....|:        :|.::     :.|..|..|.:||:.|.:|.|...:...|.         .
  Fly   179 FTIFAPV--------VSLMLSPSWESFYLVIYDLTLLGFAISSLLLVFHWSIFKSGSVTRERGTR 235

  Fly   242 RYNQGLLGNFMAFMGKRGLWTFISPSIRSPLPHDGTKWQ 280
            :|::||.||....:|||...|::||.:||.|||||..|:
  Fly   236 KYDRGLRGNLEMVLGKRMHLTWLSPFLRSDLPHDGMNWE 274

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 58/146 (40%)
CG4676NP_610853.1 zf-DHHC 99..232 CDD:279823 56/148 (38%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45469552
Domainoid 1 1.000 92 1.000 Domainoid score I7574
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 136 1.000 Inparanoid score I4533
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D423262at33208
OrthoFinder 1 1.000 - - FOG0002152
OrthoInspector 1 1.000 - - otm26486
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 1 1.000 - - X1251
109.900

Return to query results.
Submit another query.