DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and CG1407

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001286264.1 Gene:CG1407 / 36043 FlyBaseID:FBgn0033474 Length:452 Species:Drosophila melanogaster


Alignment Length:341 Identity:78/341 - (22%)
Similarity:114/341 - (33%) Gaps:124/341 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    39 FSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLLGNMLACHRNS-------------------- 83
            |.:.:|..:|.::.|    ..|||....::|.       .|.|||                    
  Fly    15 FCMAVFKWIPVLFIT----AVIAWSYYAYVVE-------LCIRNSENRIGMIFMLLFYHLFLTLF 68

  Fly    84 ---------SAVTSLPKDRQIPCPEEKHLW------------------------------HFCDH 109
                     ::|..:|...:||..|...|:                              .||:.
  Fly    69 MWSYWRTIMTSVGRIPDQWRIPDEEVSRLFRADSPDTQKRILNNFARDLPVTNRTMNGSVRFCEK 133

  Fly   110 CQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWF----TVYMHIGSLLSLATHVN 170
            |:::.|.|:.||.||.||:|:.||||.:...||...||:||..|    .||....:..||...|.
  Fly   134 CKIIKPDRAHHCSVCSCCVLKMDHHCPWVNNCVNFYNYKYFVLFLGYALVYCLYVAFTSLHDFVE 198

  Fly   171 LLIIDEQIRRQYVVL---------HFSRFFLFLKPMSCELIALNISFIINIYACILSLIML-GYQ 225
            ...:.......|...         .|...|||              ||..::|  :||:.| ||.
  Fly   199 FWKVGAYDNNGYSAQGQLNASGMGRFHILFLF--------------FIAIMFA--ISLVSLFGYH 247

  Fly   226 IPALYLNTTFYTPKDYR-------------YNQGLLGNFMAFMGKRGLWTFISPSIRS------- 270
            |..:.:|.|  |.:.:|             ||.|...||....|....:.|: |...|       
  Fly   248 IYLVLVNRT--TLESFRAPIFRVGGPDKNGYNLGRYANFCEVFGDDWQYWFL-PVFSSRGDGYSY 309

  Fly   271 PLPHDGTKWQTKQAPT 286
            |...|.::..| .:||
  Fly   310 PTSSDQSRVST-SSPT 324

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 45/179 (25%)
CG1407NP_001286264.1 zf-DHHC 129..259 CDD:279823 45/147 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467484
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.