DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and ZDHHC21

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001341047.1 Gene:ZDHHC21 / 340481 HGNCID:20750 Length:265 Species:Homo sapiens


Alignment Length:227 Identity:53/227 - (23%)
Similarity:95/227 - (41%) Gaps:45/227 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly    22 IVHPSAVGFVLVGTVLFFSVEMFYMLPRI-----YD---TDGLFFKIAWLMALFIVYNLLGNMLA 78
            :|.|.  |:..:|.::|..:....::|:|     |:   ..|:...|.:.:::|.:..|:     
Human     8 VVDPH--GWCCMGLIVFVWLYNIVLIPKIVLFPHYEEGHIPGILIIIFYGISIFCLVALV----- 65

  Fly    79 CHRNSSAVTS---LPKDRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTAT 140
                .:::|.   ||::.:|| ..|:..|..|:.|.::.|.||.||..|..|:.|.||||.:...
Human    66 ----RASITDPGRLPENPKIP-HGEREFWELCNKCNLMRPKRSHHCSRCGHCVRRMDHHCPWINN 125

  Fly   141 CVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLFLKPMSCELIALN 205
            |||..|:..|.....|..:.:..:|               .:...|: .:||.||..:.:|....
Human   126 CVGEDNHWLFLQLCFYTELLTCYAL---------------MFSFCHY-YYFLPLKKRNLDLFVFR 174

  Fly   206 ISFIINIYACILSLIMLGYQIPALYLNTTFYT 237
            ....|...|..:.:.||      :.:...|||
Human   175 HELAIMRLAAFMGITML------VGITGLFYT 200

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 33/135 (24%)
ZDHHC21NP_001341047.1 DHHC 92..217 CDD:396215 34/131 (26%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.