DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and pfa5

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001018794.2 Gene:pfa5 / 3361262 PomBaseID:SPBC691.01 Length:312 Species:Schizosaccharomyces pombe


Alignment Length:321 Identity:76/321 - (23%)
Similarity:121/321 - (37%) Gaps:79/321 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 KRFAK------IVHPSAV----GFVLVGTVLFFSVEMFYMLPRIYDTDG------LFFKIAWLMA 65
            :||:|      :|.|:|:    |:.:...:....|:....:...|...|      :||.|...:|
pombe    10 RRFSKLQKTLGVVFPAAILLSTGYTVWVFIALICVDSNIKIRNGYRNLGGGIVLIIFFFITSGLA 74

  Fly    66 LFIVYNLL-------GNMLACHRNSSAVTSLPKDRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKV 123
            .|..:.:|       ||.|..:........|......|        ..|..|:..:|.||.|.:|
pombe    75 YFSYFRVLFSSPSFCGNTLYTYYGFDNPIFLCGPNGAP--------RMCGTCKCWLPDRSHHSRV 131

  Fly   124 CECCILRRDHHCIFTATCVGHTNYRYFFWFTVY-MHIGSLLSLATHVNLLIIDEQIRRQY----- 182
            ...||.:.||:|.|....|..:|.::|:.|..| .....::.::|.:       .|.|.|     
pombe   132 SMRCIRKFDHYCSFVGKDVCFSNQKFFYQFLFYGFSAACMVLISTAI-------MISRTYHYRSL 189

  Fly   183 -----VVLHFSRF-FLFLKPMSCE---LIALNI------SFIINIYACILSLIMLGYQIPALYLN 232
                 .||.||.| .|||..|...   .:.|||      ::...||:  .|:....:....:.:.
pombe   190 PGTWIFVLVFSAFGVLFLGVMLVRHTGYLLLNINSHEAKNWKTRIYS--FSVFFPEHMDSRVLVQ 252

  Fly   233 TTFYTPKDYRYNQGLLGNFMAFMGKRGLW-TFISPSIRSPLPHDG----------TKWQTK 282
            :   .|.|..:::|...|:.|.||..  | .:|.|..||  |.||          :|.|:|
pombe   253 S---DPGDLPWDRGYSENWRAVMGDH--WYNWILPLRRS--PGDGEHFLYSPSFVSKMQSK 306

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 37/156 (24%)
pfa5NP_001018794.2 COG5273 9..283 CDD:227598 67/294 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.