DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and GABPI

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_608741.1 Gene:GABPI / 33516 FlyBaseID:FBgn0031495 Length:420 Species:Drosophila melanogaster


Alignment Length:284 Identity:69/284 - (24%)
Similarity:114/284 - (40%) Gaps:86/284 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly     4 MMIGCKYIANANPKRFAKIVHPSAVGFVLVG---------------TVLFFSVEMFYMLPRIYDT 53
            :|:|   :|..|.|. |.::..:.|||.:.|               :.|.|||  |||: .|::.
  Fly   110 LMLG---LATLNSKT-AIVLMLTLVGFTIWGMELAKRTATRTNFFLSWLVFSV--FYMI-IIFEF 167

  Fly    54 DG-------------LFFKIAWLMALFIVYNLLG----NMLACHRNSS----------------- 84
            ..             :||..|   ||:.:|:...    |:::....::                 
  Fly   168 QVPLLELAPEENYALMFFSCA---ALYCLYSAKALSPLNLVSAQYGTTPKDELPGIAEASSGEEQ 229

  Fly    85 ----------AVTSLPKDR--QIPCPEEKHLWH----FCDHCQMLVPPRSWHCKVCECCILRRDH 133
                      :|.||..|.  .:...|...|.|    .|:.|:.:.|.|::||.||..|:.||||
  Fly   230 AEAQTTLQMESVLSLDDDEVGDMDTAERSGLMHGQPNICEICRKVTPRRAYHCPVCGTCVKRRDH 294

  Fly   134 HCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLFLKPMS 198
            |..:...|:|..||   .|:.|.:.: |.::|....||.:  ..|...::|:....:.:.| |..
  Fly   295 HSYWLNCCIGERNY---VWYIVGLAL-SEIALLLGANLTL--TSICHPFMVVRPLGYPVLL-PDD 352

  Fly   199 C----ELIALNISFIINIYACILS 218
            |    |...|.|||::..||.::|
  Fly   353 CSEVFEGFDLGISFVVACYALLIS 376

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 39/127 (31%)
GABPINP_608741.1 zf-DHHC 262..399 CDD:279823 38/122 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45467561
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.740

Return to query results.
Submit another query.