DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and Zdhhc23

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001007461.1 Gene:Zdhhc23 / 332175 MGIID:2685625 Length:425 Species:Mus musculus


Alignment Length:328 Identity:66/328 - (20%)
Similarity:112/328 - (34%) Gaps:128/328 - (39%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 LVGTVLFFSVEM----FYMLPRIYDTDGLFFKIAWLMALFIVY---------------------- 70
            |:|.|:..|:.|    :|.|........|||....|.:|..:|                      
Mouse   105 LLGVVVLTSLPMLALWYYYLTHRRKEQTLFFLSLGLFSLGYMYYVFLREVVPQGRVGPTQLALLT 169

  Fly    71 -NLLGNMLACHR---NSSAVTS--LPKDRQIPCP------------------------------- 98
             .||..:||.:|   |...:::  .|.:.||.||                               
Mouse   170 CGLLLILLALYRAKKNPGYLSNDKSPSNSQIECPVKKGQEKTKGFPGTDASGSLNNRTLKDDVRG 234

  Fly    99 ----------EEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWF 153
                      :.|..|  |..||::.|.|:|||::|..|:.|.||||::..:|||.:|::.|...
Mouse   235 SSRVGLDSPAKVKEDW--CAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFILA 297

  Fly   154 TVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLFLKPMSCELIALNISFIINI------ 212
            .....:.|:..::..:|.:..|..:        |:..|.      |..:..|.|..::.      
Mouse   298 LSIFLLTSVYGISLTLNTICRDRSL--------FTALFY------CPGVYANYSSALSFTCVWYS 348

  Fly   213 --------YACILSLIMLGYQIP------------------ALYLNTTFYTPKDYRYNQGLLGNF 251
                    |..::.||.:.|.:.                  .|.::|.       :||:|.|.|:
Mouse   349 VIITAGMAYIFLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTG-------QYNRGFLRNW 406

  Fly   252 MAF 254
            :.|
Mouse   407 LQF 409

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 36/167 (22%)
Zdhhc23NP_001007461.1 DHHC 248..374 CDD:396215 33/141 (23%)
Interaction with NOS1. /evidence=ECO:0000250 422..425
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.