DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and Zdhhc8

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_006248672.1 Gene:Zdhhc8 / 303796 RGDID:1308875 Length:775 Species:Rattus norvegicus


Alignment Length:290 Identity:72/290 - (24%)
Similarity:105/290 - (36%) Gaps:90/290 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AKIVHPSAVGFVLVG-TVLFFSVEMFYML----PRIYDTDGLFFKIAWLMALFIVYNLLGNMLAC 79
            ||.:..:....:||| :.|||.....::.    |.|...:|:.|       ||::.|.       
  Rat    12 AKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAIPVYNGILF-------LFVLANF------- 62

  Fly    80 HRNSSAVTSLP-----------KDRQIPCPEEKHL----------WHFCDHCQMLVPPRSWHCKV 123
               |.|....|           |:.....|..|::          |  |..|....|||..||.|
  Rat    63 ---SMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKW--CATCHFYRPPRCSHCSV 122

  Fly   124 CECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHV------NLLIIDEQIRRQY 182
            |:.|:...||||.:...|:|..||||||.|        ||||:.|:      .||         |
  Rat   123 CDNCVEDFDHHCPWVNNCIGRRNYRYFFLF--------LLSLSAHMVGVVAFGLL---------Y 170

  Fly   183 VVLHFSRFFLFLKPMSCELIALNISFIINIYACILSLIMLGYQIPALYLNTTFY---TPKDYRYN 244
            |:.|            .|.:....:.|.....|:..|    :.||.:.| |.|:   ..:....|
  Rat   171 VLNH------------SEGLGAAHTTITMAVMCVAGL----FFIPVIGL-TGFHVVLVTRGRTTN 218

  Fly   245 QGLLGNFMAFMG--KRGLWTFISPSIRSPL 272
            :.:.|.|...:.  .||.:..:...:.|||
  Rat   219 EQVTGKFRGGVNPFTRGCYGNVEHVLCSPL 248

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 43/151 (28%)
Zdhhc8XP_006248672.1 zf-DHHC 99..224 CDD:279823 44/160 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 1 1.000 - -
TreeFam 00.000 Not matched by this tool.
32.810

Return to query results.
Submit another query.