DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and Zdhhc3

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_038937239.1 Gene:Zdhhc3 / 301081 RGDID:1309041 Length:350 Species:Rattus norvegicus


Alignment Length:246 Identity:63/246 - (25%)
Similarity:99/246 - (40%) Gaps:75/246 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    33 VGTVLFFSVEMFYMLPRIYDTDGLFFKI-AWLMALF-----------------------IVYNLL 73
            |||:.|           |.|..|:...| .|.:.|:                       ||:|||
  Rat    33 VGTMWF-----------IRDGCGIACAIVTWFLVLYAEFVVLFVMLIPSRDYAYSIINGIVFNLL 86

  Fly    74 GNM-LACHRNSSAVT--SLPKDR---------QIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCEC 126
            ..: ||.|..:....  ::||..         |:   :...:.:.|..|..:.|.|:.||.||:.
  Rat    87 AFLALASHCRAMLTDPGAVPKGNATKEFIESLQL---KPGQVVYKCPKCCSIKPDRAHHCSVCKR 148

  Fly   127 CILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFF 191
            ||.:.||||.:...|||..|.:||..||:|:   :|:||    :.||:        |..||...|
  Rat   149 CIRKMDHHCPWVNNCVGENNQKYFVLFTMYI---ALISL----HALIM--------VGFHFLHCF 198

  Fly   192 --------LFLKPMSCELIALNISFIINIYACILSLIMLGYQIPALYLNTT 234
                    .|..|.:..|:.| :.|...:: .|.:.:|.|.|:.::..:.|
  Rat   199 EEDWTKCSSFSPPTTVILLIL-LCFEALLF-LIFTSVMFGTQVHSICTDET 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 42/143 (29%)
Zdhhc3XP_038937239.1 DHHC 128..253 CDD:396215 42/137 (31%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.