DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and Zdhhc25

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001034422.1 Gene:Zdhhc25 / 300323 RGDID:1598341 Length:279 Species:Rattus norvegicus


Alignment Length:271 Identity:70/271 - (25%)
Similarity:110/271 - (40%) Gaps:68/271 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 GFVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLLGNMLACHRNSSAVTSLPKDR 93
            |:|||..:|..|..|.|::     .:|:.|.   |:|...:.:.|..||      :...|:|...
  Rat    51 GWVLVRDLLIPSNNMLYIV-----ANGMIFH---LLASLALVSHLRTML------TDPGSVPLGN 101

  Fly    94 QIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMH 158
            : |.|:..   .:|..|:..:|.|:.||.||:.||.:.||||.:...|||..|.:||..|.:|:.
  Rat   102 R-PGPDTV---SYCPDCRSAIPKRAAHCAVCKRCIRKNDHHCPWVNNCVGEDNQKYFLLFIMYIG 162

  Fly   159 IGSLLSLATHVNLLI-IDEQIRRQYVVLHFSRF-------------FLFLKPMSCELIALNISFI 209
            :.     .|||.||: |.       |:..::|.             .|||             .:
  Rat   163 LS-----GTHVLLLLGIP-------VLCSYARGEWDSSSSVSPPAPILFL-------------LL 202

  Fly   210 INIYACILSLIMLGYQIPALYLNTT----FYTPKDYRYNQGLLGNFMAFMGKRGLWTFISPSIRS 270
            :.:...:||.:||..|:..:|.:.|    .|.......|:....|..|..|......::|| ..|
  Rat   203 VALMGFVLSSVMLCTQMCTIYTDKTTTELLYQNTHSPGNRAKCANLKAICGSHISLAWLSP-FHS 266

  Fly   271 P------LPHD 275
            |      .||:
  Rat   267 PEHYKMSEPHN 277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 40/153 (26%)
Zdhhc25NP_001034422.1 zf-DHHC 109..230 CDD:279823 40/145 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.