DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and ZDHHC8

DIOPT Version :10

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001171953.1 Gene:ZDHHC8 / 29801 HGNCID:18474 Length:778 Species:Homo sapiens


Alignment Length:176 Identity:49/176 - (27%)
Similarity:69/176 - (39%) Gaps:53/176 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    20 AKIVHPSAVGFVLVG-TVLFFSVEMFYML----PRIYDTDGLFFKIAWLMALFIVYNLLGNMLAC 79
            ||.:..:....:||| :.|||.....::.    |.:...:|:.|       ||::.|.       
Human    12 AKYIPVATAAALLVGSSTLFFVFTCPWLTRAVSPAVPVYNGIIF-------LFVLANF------- 62

  Fly    80 HRNSSAVTSLP-----------KDRQIPCPEEKHL----------WHFCDHCQMLVPPRSWHCKV 123
               |.|....|           |:.....|..|::          |  |..|....|||..||.|
Human    63 ---SMATFMDPGVFPRADEDEDKEDDFRAPLYKNVDVRGIQVRMKW--CATCHFYRPPRCSHCSV 122

  Fly   124 CECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHV 169
            |:.|:...||||.:...|:|..||||||.|        ||||:.|:
Human   123 CDNCVEDFDHHCPWVNNCIGRRNYRYFFLF--------LLSLSAHM 160

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 DHHC 100..236 CDD:396215 30/80 (38%)
ZDHHC8NP_001171953.1 DHHC 99..224 CDD:396215 29/72 (40%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 293..352
PHA03247 <333..771 CDD:223021
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 509..540
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.