DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and ZDHHC1

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_037436.1 Gene:ZDHHC1 / 29800 HGNCID:17916 Length:485 Species:Homo sapiens


Alignment Length:233 Identity:60/233 - (25%)
Similarity:93/233 - (39%) Gaps:54/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IAWLMALFIV-------------------YNLLGNMLACHR--NSSAVTSLPKDRQI-------P 96
            :|||:.||..                   |..:|.:.|.|.  :.:||:..|.|..:       |
Human    54 VAWLLYLFFAVIGFGILVPLLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYAGP 118

  Fly    97 CP-----------EEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYF 150
            .|           |:.|    |:.|.:.|..||.||..|..|:...||||.:...|||..|||.|
Human   119 LPIFNRSQHAHVIEDLH----CNLCNVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLF 179

  Fly   151 FWFTVYMHIGSLL--SLATHVNLLIIDEQIR----RQYVVL--HFSRFFLFL--KPMSCELIALN 205
            ........:|.||  .:||:|.:......:|    |.:.||  |...:|:||  .|:..:..|:.
Human   180 LHSVASALLGVLLLVLVATYVFVEFFVNPMRLRTNRHFEVLKNHTDVWFVFLPAAPVETQAPAIL 244

  Fly   206 ISFIINIYACILSLIMLGYQIPALYLNTTFYTPKDYRY 243
            ....:.|...:||..:||:.: ..::...::....|.|
Human   245 ALAALLILLGLLSTALLGHLL-CFHIYLMWHKLTTYEY 281

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 42/145 (29%)
ZDHHC1NP_037436.1 Mediates interaction with STING1. /evidence=ECO:0000269|PubMed:25299331 1..271 58/221 (26%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 1..41
zf-DHHC 129..284 CDD:307600 45/158 (28%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 324..358
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 462..485
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.