DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and Zdhhc1

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_008770707.1 Gene:Zdhhc1 / 291967 RGDID:1589775 Length:502 Species:Rattus norvegicus


Alignment Length:233 Identity:59/233 - (25%)
Similarity:93/233 - (39%) Gaps:54/233 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    60 IAWLMALFIV-------------------YNLLGNMLACHR--NSSAVTSLPKDRQI-------P 96
            :|||:.||..                   |..:|.:.|.|.  :.:||:..|.|..:       |
  Rat    51 VAWLLYLFFAVIGFGVLVPLLPHHWVPAGYACMGAIFAGHLVVHLTAVSIDPADANVRDKSYSGP 115

  Fly    97 CP-----------EEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYF 150
            .|           |:.|    |:.|.:.|..||.||..|..|:...||||.:...|||..|||.|
  Rat   116 LPIFNRSQHAHVIEDLH----CNLCDVDVSARSKHCSACNKCVCGFDHHCKWLNNCVGERNYRLF 176

  Fly   151 FWFTVYMHIGSLL--SLATHVNLLIIDEQIR----RQYVVL--HFSRFFLFL--KPMSCELIALN 205
            ........:|.||  .:||:|.:......:|    :.:.||  |...:|:||  .|:..:..|:.
  Rat   177 LHSVASALLGVLLLVLVATYVFVEFFVNPMRLRTNQHFEVLKNHTDVWFVFLPAAPVETQAPAIL 241

  Fly   206 ISFIINIYACILSLIMLGYQIPALYLNTTFYTPKDYRY 243
            ....:.|...:||..:||:.: ..::...::....|.|
  Rat   242 ALAALLILLGLLSTALLGHLL-CFHIYLMWHKLTTYEY 278

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 41/145 (28%)
Zdhhc1XP_008770707.1 DHHC 126..281 CDD:396215 44/158 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.