DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and ZDHHC23

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001307395.1 Gene:ZDHHC23 / 254887 HGNCID:28654 Length:435 Species:Homo sapiens


Alignment Length:194 Identity:49/194 - (25%)
Similarity:79/194 - (40%) Gaps:61/194 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly   101 KHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSL 165
            |..|  |..||::.|.|:|||::|..|:.|.||||::..:|||.:|::.|.       :..|:.|
Human   257 KEDW--CAKCQLVRPARAWHCRICGICVRRMDHHCVWINSCVGESNHQAFI-------LALLIFL 312

  Fly   166 ATHVN--LLIIDEQIRRQYVVLHFSRFFLFLKPMSCELIALNISFIINI--------------YA 214
            .|.|.  .|.:|...|.:.|   |:..|.      |..:..|.|..::.              |.
Human   313 LTSVYGITLTLDTICRDRSV---FTALFY------CPGVYANYSSALSFTCVWYSVIITAGMAYI 368

  Fly   215 CILSLIMLGYQIP------------------ALYLNTTFYTPKDYRYNQGLLGNFMAF--MGKR 258
            .::.||.:.|.:.                  .|.::|.       :||:|.|.|:..|  :|.|
Human   369 FLIQLINISYNVTEREVQQALRQKTGRRLLCGLIVDTG-------QYNRGFLRNWHQFSTLGTR 425

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 41/168 (24%)
ZDHHC23NP_001307395.1 MerC 96..>151 CDD:281231
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 215..255
zf-DHHC 258..384 CDD:279823 38/143 (27%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.