DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and erf2

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_595766.1 Gene:erf2 / 2541058 PomBaseID:SPBC3H7.09 Length:350 Species:Schizosaccharomyces pombe


Alignment Length:297 Identity:69/297 - (23%)
Similarity:113/297 - (38%) Gaps:90/297 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    26 SAVGFVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLLGNMLACH--------RN 82
            |....:|.| ||||....|::...:.....:.|  |:|.||.:|     :|..|.        ||
pombe    90 SLFALILPG-VLFFIFSAFWLWHHVSPAVPITF--AYLYALAVV-----SMFKCSTADPGILPRN 146

  Fly    83 SSAVTSLPKDRQIPCPEEKHL-------------WHFCDHCQMLVPPRSWHCKVCECCILRRDHH 134
            :.::|..|.......||::.:             ..:|..|.:..|||:.||.:|:.|:...|||
pombe   147 AYSLTYNPAHPWSVIPEDRKVLVGSTRSDSVFVNTVYCHTCHLYRPPRASHCHLCDNCVEYLDHH 211

  Fly   135 CIFTATCVGHTNYRYFFWFTV--------------YMHIGSL-----LSLATHVNLLIIDEQIRR 180
            ||:..||:|..||||:|.|.:              |..|||.     .:.|.|         :||
pombe   212 CIWLNTCIGRRNYRYYFIFLLSVVLSALYLTGLGFYTSIGSFHESTDTNFAAH---------LRR 267

  Fly   181 QYVVLHFSRFFLFLKPMSCELIALNISFIINIY---ACILSLIMLGYQIPAL--------YLNTT 234
            .:.                     .:||.:.||   ..||..|:..||...:        ||...
pombe   268 PWA---------------------GVSFFLGIYGALGAILPGILFCYQCYLISVGQNVHEYLRAK 311

  Fly   235 FYTPKD-YRYNQGLLGNFMAFMGKRGLWTFISPSIRS 270
            ....:| :.::..:..||:..:.:....:::.|:.:|
pombe   312 STETEDVHPFHDSIWLNFLVVLCRPKNVSYVRPTRKS 348

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 42/178 (24%)
erf2NP_595766.1 COG5273 57..350 CDD:227598 69/297 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.