DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and dhhc-11

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_491675.3 Gene:dhhc-11 / 188748 WormBaseID:WBGene00020694 Length:316 Species:Caenorhabditis elegans


Alignment Length:181 Identity:44/181 - (24%)
Similarity:70/181 - (38%) Gaps:32/181 - (17%)


- Green bases have known domain annotations that are detailed below.


  Fly   106 FCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVN 170
            ||..|::.....:.|||.|..||...||||::...|:|..|||.|....:.:::.|:......|.
 Worm    97 FCSICEVRTYRETKHCKRCNFCIDDFDHHCVWLNNCIGGKNYRPFVVLVICVNVFSMFCFGLSVV 161

  Fly   171 LLI--IDEQIRRQYVVLHFSRFFLFLKPMSCELIALNISFIINIYACILSLIMLGY----QIPAL 229
            :..  |.....|..:.|...:.|            |.||:   ::.|::.:|:.|.    ....|
 Worm   162 IFFSWITNSDERALIKLVQDKDF------------LKISW---VFLCVICIIIYGVLSVTTAHLL 211

  Fly   230 YLNTTFYT--PKDYRY--NQGLLGNFMAFMGKRGLWTFISPSIRSPLPHDG 276
            |.:...:.  ...|||  ||       ....|.|..:.:||:.......||
 Worm   212 YFHFKLFKVGQTTYRYMTNQ-------RRSAKVGAISHVSPTHSQTHRRDG 255

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 33/135 (24%)
dhhc-11NP_491675.3 DUF485 14..75 CDD:294756
zf-DHHC 91..231 CDD:279823 36/148 (24%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.