DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and dhhc-12

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_492753.2 Gene:dhhc-12 / 186602 WormBaseID:WBGene00010323 Length:310 Species:Caenorhabditis elegans


Alignment Length:211 Identity:54/211 - (25%)
Similarity:88/211 - (41%) Gaps:35/211 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly    31 VLVGTVLFFS-VEMFYMLPRIYD--TDGLFFKIAWLMALFIVYNLLGNMLACHRNSSAVT-SLPK 91
            :.|||:...: |.:|.|:|..::  .:..||...:::.::|.|:::.:.......:..|. ..|.
 Worm    45 IFVGTLCNVTYVVIFKMIPVEWNECQNMSFFVFRFVLLIYIYYSVVFHYYKARTLTPVVNPGTPS 109

  Fly    92 DRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVY 156
            |            .||..|.....|.:.|||.|:.||.|.||||.....|||..|..:||.|..|
 Worm   110 D------------SFCIKCNNWKGPSTSHCKACDKCIYRMDHHCPHIGQCVGAHNQSHFFLFLFY 162

  Fly   157 MHIGSLLS-----------LATHVNLLII-DEQIRRQYVVLHFSR-FFLFLKPMSCELIALNISF 208
            :.|.:.|.           :.|...|..| |:|....|.   |:| ::|..:....|...:..:|
 Worm   163 LQIATGLFFLMATTFWMKWIETRKELTAIPDDQCWPPYC---FNRYYYLITRSQGTEDTMVKFAF 224

  Fly   209 IINIYACILSLIMLGY 224
            .:.:   .|..||.|:
 Worm   225 FLFV---TLHWIMWGF 237

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 40/138 (29%)
dhhc-12NP_492753.2 zf-DHHC 39..>172 CDD:303066 39/138 (28%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160165797
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - O PTHR22883
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.