DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and Zdhhc7

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_598728.1 Gene:Zdhhc7 / 102193 MGIID:2142662 Length:308 Species:Mus musculus


Alignment Length:214 Identity:52/214 - (24%)
Similarity:92/214 - (42%) Gaps:45/214 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 FVLVGTVLFFSVEMFYMLPRIYDTDGLFFKIAWLMALFIVYNLLGNML---ACHRNSSAVTSLPK 91
            ||:...:|..|.:.:|.:     .:|:.|.   .:|:..:.:.|..||   ......:|.....:
Mouse    63 FVVTFVMLLPSKDFWYSV-----VNGVLFN---CLAVLALSSHLRTMLTDPGAVPKGNATKEYME 119

  Fly    92 DRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCILRRDHHCIFTATCVGHTNYRYFFWFTVY 156
            ..|:. |.|  :.:.|..|..:.|.|:.||.:|:.||.:.||||.:...|||..|.|:|..||:|
Mouse   120 SLQLK-PGE--VIYKCPKCCCIKPERAHHCSICKRCIRKMDHHCPWVNNCVGEKNQRFFVLFTMY 181

  Fly   157 MHIGSLLSLATHVNLLIIDEQ----IRRQYVVLHFSRFFLFLKPMSCELIALNISFIINIYACIL 217
            :.:.|:     |. |::...|    :|.|:.              .|...:..|:.|:.::.|:.
Mouse   182 IALSSV-----HA-LILCGLQFISCVRGQWT--------------ECSDFSPPITVILLVFLCLE 226

  Fly   218 SL-------IMLGYQIPAL 229
            .|       :|.|.||.::
Mouse   227 GLLFFTFTAVMFGTQIHSI 245

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 38/141 (27%)
Zdhhc7NP_598728.1 DHHC 131..258 CDD:366691 37/135 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.