DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and si:ch211-223a10.1

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:XP_009305694.1 Gene:si:ch211-223a10.1 / 101884554 ZFINID:ZDB-GENE-090313-86 Length:544 Species:Danio rerio


Alignment Length:279 Identity:65/279 - (23%)
Similarity:116/279 - (41%) Gaps:82/279 - (29%)


- Green bases have known domain annotations that are detailed below.


  Fly    19 FAKIVHPSAVGFVLVG----TVLFFSVEMFYMLPRIYDTD--------------GLFFKIAWLMA 65
            |.::.:|..:|.:..|    ||.|    ::.::|..:...              |||:|      
Zfish   299 FQRLPNPVYLGTLTAGLIHSTVCF----LYKIIPSFWPAHTLLHLSLVHFCVLAGLFWK------ 353

  Fly    66 LFIVYNLLGNMLACHRNS--SAVTSLPKDRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCECCI 128
              ::....|.:.....:|  |::..|.:..|.|.       .||.:|:::......||::|:.||
Zfish   354 --VLKQSPGQLKDADTDSRFSSIGDLMEAGQSPD-------RFCIYCELIQVENCKHCRLCDMCI 409

  Fly   129 LRRDHHCIFTATCVGHTNYRYFFWFTVYMHIGSLLSLATHVNLLIIDEQIRRQYVVLHFSRFFLF 193
            ...||||:|...|||..|:|.|..|.:.|.:..|:.:.:.:                    |:|:
Zfish   410 KDYDHHCLFINQCVGRENHRTFILFLMSMVMAHLIFILSAI--------------------FYLY 454

  Fly   194 LKPMSCEL-----IALNISFIINIYAC-ILSLI----MLGYQIPALYLNTTFYTPKDY-RYN--- 244
            ||....:|     :|...::::.:... :|||.    :||.|:.|:...||.|    | ||:   
Zfish   455 LKVSGLQLSDWGSVAGREAWVLLLTLLNLLSLFWVGWLLGEQLDAISRGTTTY----YRRYDLKG 515

  Fly   245 ---QGLLGNFMAFM--GKR 258
               :..||..::|:  |||
Zfish   516 PSKRQRLGTVVSFLLEGKR 534

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 37/145 (26%)
si:ch211-223a10.1XP_009305694.1 ANK repeat 7..36 CDD:293786
Ank_2 9..102 CDD:289560
ANK 39..159 CDD:238125
ANK repeat 39..69 CDD:293786
ANK repeat 71..102 CDD:293786
Ank_2 76..162 CDD:289560
ANK repeat 138..170 CDD:293786
Ank_4 139..192 CDD:290365
zf-DHHC 384..509 CDD:279823 39/155 (25%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_COG5273
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.