DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG13029 and slc66a1l

DIOPT Version :9

Sequence 1:NP_648928.1 Gene:CG13029 / 39886 FlyBaseID:FBgn0036670 Length:288 Species:Drosophila melanogaster
Sequence 2:NP_001123690.1 Gene:slc66a1l / 100170445 XenbaseID:XB-GENE-5794175 Length:303 Species:Xenopus tropicalis


Alignment Length:222 Identity:38/222 - (17%)
Similarity:69/222 - (31%) Gaps:105/222 - (47%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 KYIANANPKRFAKIVHPSAVGFV-LVGTVLFFSVEMFYM---LPRIY------DTDG---LFFKI 60
            ||..|.:.:     :...::|.. :.|.:..:...:||:   .|::|      .|:|   |.|.:
 Frog   164 KYDKNTDVE-----ISQKSLGITEMSGFICGYVSSVFYLGSRFPQLYKNFHRKSTEGTSYLLFAL 223

  Fly    61 AWLMALFIVYNLLGNMLACHRNSSAVTSLPKDRQIPCPEEKHLWHFCDHCQMLVPPRSWHCKVCE 125
            |          :|||   |...:|.:..||                                   
 Frog   224 A----------MLGN---CTYGTSLLLKLP----------------------------------- 240

  Fly   126 CCILRRDHHCIFTATCVGHTNYRYFFWFTVYMH-----IGSLLSLATHVNLLIIDEQIRRQYVVL 185
                           .|||...:|.      ||     |||.       .:||:|..:..|:::.
 Frog   241 ---------------AVGHHMSQYI------MHHLPWLIGSF-------GVLILDFFMTAQFIIY 277

  Fly   186 HFSRFFLFLKPMSCELIALNIS-FIIN 211
            ...:     ...|.:|:|:.:. .::|
 Frog   278 RKDK-----TNKSADLLAIEVEPLLVN 299

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG13029NP_648928.1 zf-DHHC 100..236 CDD:279823 17/118 (14%)
slc66a1lNP_001123690.1 PQ-loop 44..103 CDD:282099
PQ-loop 185..238 CDD:282099 15/65 (23%)
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.